KEGG   Mycobacterium liflandii: MULP_03016Help
Entry
MULP_03016        CDS       T02444                                 

Gene name
fucA_2
Definition
class II aldolase/adducin domain protein (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mli  Mycobacterium liflandii
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mli00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MULP_03016 (fucA_2)
Enzymes [BR:mli01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MULP_03016 (fucA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3236871..3237656)
Genome map
AA seq 261 aa AA seqDB search
MATTFSDSKSELMRRAQERLDAQTPESQLTTRQKVALTCRALFDAGHDSGLAGQITARAQ
RPGTYYTQQLGLGFDEITEDNLLLVDEDLNVLEGSAMANPANRFHSWIYRERPDVQCIVH
THGFHTAALSMLKVPLVVSHMDTTPLYDDCAFLADWPGVPVGNEEGEIISAALGNKKAIL
LAHHGQLIAGVSIEEACTLAVLIERAAKLQLAAMSAGTIAELPDQLAREAHDWTLTPSRS
RANFAYYARRALARHPDALSS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccactttctccgattccaagtccgaattgatgcgacgggcccaggaacgcctc
gatgcccagacgcccgaatctcagctgaccacccggcaaaaggtcgcgttgacctgccgg
gcattgttcgacgccggccacgattccggtctggccgggcagatcaccgcgcgtgcgcag
cggcccggcacctattacacccaacaactcggcttgggattcgacgagatcaccgaagac
aacttgctgttggtcgacgaggacctcaatgttctcgagggctccgcaatggccaacccg
gcaaatcgatttcacagctggatctaccgcgaacggccggacgtgcagtgcatcgttcat
acccatgggttccacaccgcggcgttgtcgatgctgaaggtgccgctggtcgtttcgcac
atggacaccacgccgctctatgacgactgcgctttcctcgccgactggccaggcgtgccg
gtgggtaacgaggaaggcgagatcatcagcgccgcattgggaaacaagaaggcgatcctt
cttgcgcaccacgggcagttgatagccggcgtcagcatcgaggaggcctgcacgctggcg
gtcctgatcgaacgcgccgccaaactgcaactggcggccatgagtgcgggaacaatcgcc
gaactaccggaccaactggcccgcgaggctcacgattggaccctgacaccttcccgcagc
cgggcgaactttgcctactacgcgcgtcgcgcactggcccgtcaccccgatgcgctgagc
agctga

DBGET integrated database retrieval system