KEGG   Mycobacterium liflandii: MULP_03106Help
Entry
MULP_03106        CDS       T02444                                 

Definition
O-methyltransferase (EC:2.1.1.6)
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mli  Mycobacterium liflandii
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mli00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MULP_03106
Enzymes [BR:mli01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     MULP_03106
Exosome [BR:mli04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MULP_03106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3342911..3343663
Genome map
AA seq 250 aa AA seqDB search
MRLNARFAPLRWSVLRLALAFRTLLRTGQVGDGREAAAVDYVLAHARAGDIDDVLATIDK
FAYEKSILVNVGDEKGLLLDAAVRRADPALALELGTYCGYGALRIARAAPQAKVYSVELA
EANAANARQIWAHAGVADRVTCVVGTIGDGGPTLDALATEHGFAPGALDFVFVDHDKKAY
LDDLQSILDREWLHRGSIVVADNVKVPGAPEYHEYMRHHQGTLWDTTEHKTHLEYQTLVS
DLVLESDYLG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcaacgcacgcttcgctccgttgcggtggtcggtattgcgcctggcgctggca
tttcgcaccctgctcagaacgggccaggtcggcgacggccgcgaggccgcggctgtcgac
tatgtgctcgcgcatgcccgcgccggcgatatcgacgacgtgctggccaccatcgacaag
ttcgcctacgaaaagtccatcctggtcaacgtcggcgacgagaagggactactactcgat
gccgcggtgcggcgcgccgatccggcactggcgctggagctgggtacctactgcgggtat
ggcgcgctgcggatcgcgcgggccgcaccgcaggccaaggtgtactccgtcgaactcgcc
gaagccaacgccgccaacgcccggcagatctgggctcatgccggcgttgccgatcgcgtg
acatgtgtcgtgggcaccattggcgacggcggacccaccctggacgcactcgcgaccgag
cacggattcgcccccggtgcgctcgatttcgtctttgtcgatcacgacaagaaggcctac
ctcgacgacctgcaaagcatcctggaccgggagtggctgcatcggggctcgatcgtggtg
gccgacaacgtcaaggtgcccggcgctcccgagtaccacgaatacatgcggcaccatcag
ggcacgctatgggacaccaccgagcacaagacccacctcgagtaccagaccctggtatcg
gatctggtgctcgaatccgactacttggggtga

DBGET integrated database retrieval system