KEGG   Mycobacterium liflandii: MULP_03205Help
Entry
MULP_03205        CDS       T02444                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase TrpC
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mli  Mycobacterium liflandii
Pathway
mli00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mli01100  Metabolic pathways
mli01110  Biosynthesis of secondary metabolites
mli01130  Biosynthesis of antibiotics
mli01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mli00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MULP_03205 (trpC)
Enzymes [BR:mli01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MULP_03205 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS OMPdecase FMN_dh QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AGC62923
UniProt: L7V905
Position
complement(3481683..3482501)
Genome map
AA seq 272 aa AA seqDB search
MSPATVLDSILEGVRADVAAREALVGMTEIKAAAVAAPPPLDVMAALRQPGIGVIAEVKR
ASPSAGSLAPITDPAKLARAYEDGGARIISVLTEGRRFQGSLDDLDAVRAAVSIPLLRKD
FVVQPYQIHEARAHGADMLLLIVAALDQSALVSMLDRTESLGMTALVEVHTEQEADRALK
AGAKVIGVNARDLTTLEVDRDCFARIAPGLPSNVIRIAESGVRGTNDLLAYAGAGADAVL
VGEGLVKSGDPRAAVADLVTAGTHPSCPKPAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagtccggcaacagtgcttgactcgattctcgagggagtccgggccgacgttgccgcg
cgcgaggcgcttgtcggcatgaccgagatcaaggccgccgccgtggcggcgccgccgcca
ctggacgtgatggccgccctgcgtcagccgggtattggtgtcatcgccgaggtgaagcgt
gccagcccatctgctggctcgttggcgcccatcaccgaccccgccaagctggcgcgtgcc
tatgaggatggcggcgcgcgcatcatcagtgtgttgaccgagggccggcgttttcagggt
tcgctcgacgatctcgatgcggtgcgcgcggcagtctctattccgctattgcgcaaagac
tttgtggttcagccctatcagatccatgaggcgcgggcgcacggtgcggacatgctgctg
ctcattgtcgccgcattggaccagtcagcgctggtgtccatgctggaccggaccgaatcg
ctggggatgaccgcgcttgtcgaggtgcacaccgagcaggaggcggaccgggcattgaag
gctggggccaaggtcatcggcgtcaatgcgcgcgatctcaccaccttggaggtggaccgg
gactgcttcgcgcgaatcgctccgggattacccagcaacgtgatcaggattgccgagtcc
ggcgtgcgcggcaccaatgatctgctggcgtatgccggtgctggcgcagacgccgtgttg
gtcggcgaagggctggtcaagagtggtgacccacgggcggcggttgctgatctggtcacc
gcaggcacccatccgtcctgcccaaaaccagcccgctaa

DBGET integrated database retrieval system