KEGG   Mycobacterium liflandii: MULP_03226Help
Entry
MULP_03226        CDS       T02444                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase HisD
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mli  Mycobacterium liflandii
Pathway
mli00340  Histidine metabolism
mli01100  Metabolic pathways
mli01110  Biosynthesis of secondary metabolites
mli01230  Biosynthesis of amino acids
Module
mli_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mli00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    MULP_03226 (hisD)
Enzymes [BR:mli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     MULP_03226 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AGC62940
UniProt: L7V8S1
Position
complement(3503469..3504704)
Genome map
AA seq 411 aa AA seqDB search
MEAVLPKVRPIVAAVAERGAQAALEFCESFDGVRPAAVRVPQAALAAALDELSPDVRDAL
QVMIERTRAVHADQRRTDVVTTLGPGATVTERWIPVERVGLYVPGGNAVYPSSVVMNVVP
AQAAGVDSLVVASPPQASHGGLPHPTILAAARLLGVDEVWAVGGAQAVALLAYGGTDVDG
HELAPVDMITGPGNIYVTAAKRLCRSQVGIDAEAGPTEIAILADHTADPAHVAADLISQA
EHDEMAASVLVTPSEHLADATDAELAAQLATTVHHERVTTALGGRQSAIILVDDLDAGVK
VVNAYAAEHLEIQTADAPQVASRIRSAGAIFVGAWAPVSLGDYCAGSNHVLPTAGFARHS
SGLSVQTFLRGIHVVDYTEAALKDVSGHVLTLAKAEDLPAHGEAVRRRFER
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
gtggaggcggtcttgccgaaggtccggccgattgtggcggcggtggccgaacgcggggcg
caggccgcgctggaattctgtgagtcgttcgacggggtgcggcccgcggccgtccgggtg
ccccaggccgcgctggcagcggcgctggacgagctcagcccagacgttcgcgacgcgctg
caggtgatgatcgagcggacccgggcggtgcacgccgatcagcgccgaaccgatgtcgtc
acgacgctcggcccgggagctaccgtgaccgagcgttggatccccgtcgagcgagtcggt
ttgtacgtgccggggggcaacgcggtctacccgtccagtgtggtgatgaacgtggtgccc
gcgcaggcggcgggggtggattcgctcgtggtcgccagcccgccccaggccagccatggc
gggctgccgcatccgaccattctggccgcggcccgcctgttgggagtcgacgaggtatgg
gcggtcggaggggcacaggcggttgccttgctggcctatggcggcaccgacgtcgacggt
cacgagttggcgccggtcgacatgatcaccgggccgggcaacatctacgtcacggccgca
aagcggctgtgccgttcgcaggtaggcattgacgccgaagcggggccgaccgaaatcgcg
atcctggccgaccacacagccgaccccgcacacgttgccgcggatctgatcagtcaggcc
gagcacgatgagatggctgccagtgtgctggttaccccgagtgagcacctcgccgatgcc
accgatgccgaactggctgctcagttggcgacgacggtgcatcacgagcgagtgacaacc
gcgttggggggtcgccagtcggcgatcatcttggtcgacgatctcgatgccggcgtcaag
gtggtgaatgcctatgcggctgagcacctcgagatccagaccgcagacgcgccacaagtc
gccagcaggatacgttcggctggcgccatcttcgttggggcgtgggcgccggtgagcctc
ggtgactactgcgcggggtccaaccatgtgttgccgaccgcgggatttgcgcggcattcc
agcggcctgtcggtgcagaccttcctgcgtggcatccacgttgtcgactacaccgaggcg
gctctcaaagacgtgtcggggcatgtgcttaccctcgccaaggccgaagatctgccggcg
cacggggaagcggtaaggcggaggttcgaacgatga

DBGET integrated database retrieval system