KEGG   Mycobacterium liflandii: MULP_03477Help
Entry
MULP_03477        CDS       T02444                                 

Gene name
asnB
Definition
asparagine synthetase AsnB (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mli  Mycobacterium liflandii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mli00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MULP_03477 (asnB)
Enzymes [BR:mli01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     MULP_03477 (asnB)
Peptidases [BR:mli01002]
 Cysteine Peptidases
  Family C44
   MULP_03477 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3769892..3771946
Genome map
AA seq 684 aa AA seqDB search
MATRRARPPQASPIAAYWGAVCGLLAFVAAPAGAAETQGTDTQLAQADQAALAARADSAI
AGASHLMRHRGPDEPGTWADPDADGSVVFGFNRLSIIDIEHSHQPLRWGPPEAPDRYVLV
FNGEIYNYLELREELRAEHGATFATDGDGEAIVAGYHHWGADVLRRLRGMFAFALWDTVT
RELFCARDPFGIKPLFMATGPGGTALASEKKCLLGLVDLVGFDTEIDHRALQHYTVLQYV
PEPETLHRGVRRLESGCYARIRPGCNPVVTRYFVPRFAATPITSATERARYDEITAVLED
SVAKHMRADVTVGSFLSGGIDSTAIAALAIRHNPRLITFTTGFEREGFSELDVAVASAEA
IGARHIAKVVSAEEFVAALPEIVWYLDEPVADPALVPLFFVAREARKHVKVVLSGEGADE
LFGGYTIYREPLSLKPFDYLPRPLRRSMGKVSKPLPEGMRGKSLLHRGSLTLEERYYGNA
RSFSDAQLQDVLPGFRPQWTHTDVTAAVYAGSAGWDPVARMQHIDLFTWLRGDILVKADK
MTMANSLELRVPFLDPEVFAVAARLPLQAKITRTTTKYALRRALEPIVPAHVLHRPKLGF
PVPIRHWLRAGGLLEWAYAMVATSQAGHLIDLAAVNRMLDEHRTGASDHSRRLWTLLIFM
LWHAIFIERSITPQISEPQYPVEL
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggcgacccgccgggctcgacccccacaagcttcgccaattgcggcatactggggcgcc
gtgtgtggactgctggccttcgttgcggccccggccggcgctgccgagacgcaaggcacc
gatactcaactcgcccaggccgaccaagccgcgctggccgcgcgagccgacagcgcaatc
gcgggcgcgtcgcacctgatgcgccaccgcggccccgacgagcccggcacctgggcagac
cccgatgccgacggttcggtggtcttcggattcaaccggttgtccatcatcgacatcgag
cattcgcaccaaccgctgcgatgggggccacccgaagctcctgaccgctatgtcttggtg
ttcaacggcgagatctacaactacctcgaactacgcgaggaactgcgtgccgagcacggc
gccaccttcgccaccgatggtgatggtgaggccatcgtcgccggttaccaccactggggt
gccgacgtgctgcggcgactccgcggcatgttcgccttcgcgctgtgggacacggtcacc
cgcgaactgttctgtgcccgcgatccgttcggcatcaaaccgctgttcatggcgaccgga
ccgggcggcaccgcgctggctagtgagaagaagtgtctactgggcctggtcgacttggtg
ggattcgacactgaaatcgaccaccgggcgctacagcactacacagtcctgcagtacgtc
cccgaacccgagacactgcatcgcggagtccgacggctcgaatcgggctgctacgcgcgc
atccggcccgggtgcaaccccgtagtcacccgttactttgtgccgcggtttgccgccaca
ccgatcaccagcgccaccgagcgggcgcgctacgacgagatcaccgcggtgctagaggac
tcggtggccaaacacatgcgcgccgacgtcactgtcggttcgtttctgtcaggcgggatc
gactccacggccatcgcggcgctggccatccggcacaatccgcggctgatcacctttacc
accggcttcgaacgcgagggtttttccgagctcgacgtggcggtggcctcggccgaagcc
atcggcgcccgccacatcgccaaggtggtcagcgcggaggaatttgtggccgcattgccc
gaaattgtctggtatctcgacgagccggtcgccgatccggcgctggtaccactgttcttc
gtggcccgcgaggcccgcaagcacgtcaaggtggtgctctccggggagggcgccgacgag
ctgtttggcggatacacgatctaccgcgagccgctctcgctgaaacccttcgactatcta
ccccgaccgctgcgacggtcgatgggtaaggtctccaaacccctgcccgagggtatgcgc
ggaaaaagcctgctccatcgcggctcgctgacgctcgaggagcgctactacggcaacgcc
cgaagcttctccgacgcccaactgcaagacgtgctgcccggattccggccgcagtggaca
cacaccgatgtgaccgctgcggtctacgccgggtcagcgggctgggacccggtagccaga
atgcagcacatcgatctgttcacttggctacgcggcgacattctggtgaaggccgacaag
atgacgatggccaattcgctcgaactgcgggtgccattcctggatcccgaggtgttcgcc
gtcgccgcccgattgccgctgcaggccaaaatcacccgcaccaccaccaagtacgcgcta
cggcgcgcattggagccgattgtcccggcacatgtgctgcaccgacccaagctcgggttc
ccagtcccgatccggcactggttgcgcgccggcggactgttggagtgggcctatgcgatg
gtggccacgtcgcaggcgggtcacctgatcgacctggcagcggtcaaccggatgctcgac
gagcaccgcaccggcgccagcgatcacagccgccggctgtggaccctgctgatcttcatg
ctgtggcacgcgatcttcatcgagcgcagcatcacaccacagatcagcgagccccagtat
ccggtcgagctctag

DBGET integrated database retrieval system