KEGG   Mycobacterium liflandii: MULP_04274Help
Entry
MULP_04274        CDS       T02444                                 

Definition
aldehyde dehydrogenase (EC:1.2.1.3)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
mli  Mycobacterium liflandii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mli00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MULP_04274
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MULP_04274
   00620 Pyruvate metabolism
    MULP_04274
   00650 Butanoate metabolism
    MULP_04274
  Lipid metabolism
   00071 Fatty acid degradation
    MULP_04274
  Amino acid metabolism
   00350 Tyrosine metabolism
    MULP_04274
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MULP_04274
   00626 Naphthalene degradation
    MULP_04274
Enzymes [BR:mli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MULP_04274
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MULP_04274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4667464..4670121
Genome map
AA seq 885 aa AA seqDB search
MTTTPTESASPVEAPAIDNLRTAEIDAIVDAAAEAARAFRKLDQQQVDAIVEAMVRAGVR
AAGELAGVAIEETGFGVFEDKVVKNYVATEFLHDYLRGKKSVGVIDEDVEHNIVYVAEPI
GVVLGITPVTNPTSTVLFKAIVAAKTRNAILFRPSPYAVRCCEQSIEILRTAAEAAGMPP
GALQVIPDAAHEVTHYLFKHPKVDFIWVTGGPKIVALANSAGKPGLSVGPGNAPIYIHKT
ADLKGAVVDILISKTFDSSVICPAEQTCIIDDEMIAEFERMGAQLLTADQAKAVAEFAFG
CGDKVSLDAVGQKAPELAARAGFSVPPTVKVLLAQLPSDLDELAAHPLVQEKLMPVLGVV
RARSVQHGIDAAVLVTEHGGLGHTSAIYANDDDVIEAYGLAVRTGRILVNAPTAVGALGG
IYNNLTPTFSLGCGTWGGSSTTENVNYRQLLNIKTVSRRRTPPQWFRVPSNTYFNEGALD
NLRELDCETVVVVTDALTEERGVVEALRGKLRAQHVQVFSEVTPEPDETTIRRGVALMQR
VQPDLLIAIGGGSVLDAGKAMRLFYEHPEKSLDALTMPFLDPRKRVADYPTDRHRIQLVA
VPTTSGTGSEVSPAAVLTVGGKKETLVDYSLVPDLAIVDPVLTSSMPQKLTADTGIDALT
HALEAIVSIFASPYTDALCAQAVRLIFDALPRAYDDPDDLSARTSMSNAATLAGLAFSNA
FVGTNHALAHAVGAKFSVPHGRANGIFLPHVLRYNASLPTKFMPAPGYSAYIAPDKYAQL
GQLVFGGHLPDDSRQRLFAGVDDLLDRLDMPRSLREFGVDEQGFLAALPTLAMTAFEDLS
NRTNPRMPLVSEITDLLRLGYYGDTGVGEPALAPIKPGDVDGRSV
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgacaccaaccgagtccgcctcccccgtcgaagcacccgcgatcgacaatcta
cgcaccgccgaaatcgacgccattgttgatgccgccgctgaggcggcccgcgccttccgc
aagcttgaccagcagcaggtcgacgcgatcgtcgaggcgatggtgcgggccggggtgcgc
gcggccggcgaactggccggtgtggcgatcgaggagacgggcttcggcgtcttcgaggac
aaggttgtcaagaactatgtggccaccgaattcctgcacgactatctgcgcggcaagaaa
tcggtgggcgtcatcgacgaggacgtcgagcacaacatcgtctatgtggccgaaccgatc
ggggtggtgctcggcattaccccggtgaccaacccgacctcgacggtgttgttcaaggcg
atcgtggccgcaaagacccgcaacgccattcttttccgaccgtcaccgtatgcggtgcgc
tgctgcgaacaaagcatcgagatcctgcgcaccgcggccgaagcggccgggatgcctccc
ggggcgctgcaggtcatccccgatgccgctcacgaggtgacgcactacttgttcaaacac
ccgaaggtcgacttcatctgggtgaccggcgggccaaagatcgtcgcgttggcgaactcg
gcaggaaagccggggctcagtgtcggtcctgggaatgcgccgatctacattcacaagacc
gcagacctcaagggcgcggtggtcgacatactcatctcgaaaacgtttgactcatcggtc
atctgcccggccgagcagacctgcatcatcgacgacgagatgatcgccgagttcgagcgg
atgggggcccagttgctcaccgccgaccaggcgaaggcggtggccgagttcgcgtttggt
tgtggcgacaaggtctccctcgatgcggtcgggcagaaggcgccagaactggccgcccgg
gccggattcagcgtgcctcccacggtgaaagtgctgctggcgcagttgccgtcggacttg
gacgaactcgccgcccacccactggtgcaggagaagctgatgccggtgctcggggtggtg
cgcgcgcgcagtgtgcagcacggcatcgacgccgccgtcttggtcaccgagcacggcggg
ttgggccatacctcggcgatctacgccaacgacgacgacgtcatcgaggcatacgggttg
gcggttcgcaccggccgcatcctggtcaacgcgccaaccgcggtcggagcgctcggcggg
atctacaacaatctgacacccacgttctcgctgggctgtggcacctggggcggatcgagc
accaccgagaacgtcaactatcgccagttgctcaacatcaagacggtgtcgcggcggcgc
acgccgccgcaatggttccgcgtgccgtccaacacctacttcaacgaaggggcactggac
aatctgcgcgagctcgactgcgagaccgtcgtggtggtaaccgacgcactgaccgaggag
cgcggcgtggtggaggcgctgcgtggcaagttgcgcgcccagcacgtgcaggtgttcagc
gaagtgacacccgagcccgacgagacgaccatccgccgcggtgtcgcgctcatgcagcgg
gtgcagcccgatctgctgatcgccatcggcggcggttcggtgctcgacgccggcaaggcg
atgcggctgttctacgagcacccggagaaaagcctcgacgctttgacgatgcccttcctc
gacccgcgcaagcgggtggctgactatccgaccgaccgtcatcgcatccaactcgttgct
gtcccaacgacatcgggcactgggtcggaagtttcgccggcggcggtgttgaccgttggc
gggaagaaggagacgctcgtcgactacagcttggtccccgacctggcgatcgtggacccg
gtgctgacctcgtcaatgccgcagaagctgaccgcggacaccggcatcgacgcgctgacc
cacgcgctggaggcgatcgtgtcgatcttcgcctcgccctacacggatgcgttgtgcgcc
caggcggtacggctgatcttcgatgccctgcccagggcgtacgacgatcccgacgatctg
tccgcccgaacgagcatgtccaatgcggcgacgcttgccggcctggccttctcgaatgcc
ttcgtcgggaccaatcatgccctcgcccacgccgttggtgcgaaattctcggtcccccat
ggccgggcgaacggcatcttcctgccgcacgtgctgcgctacaacgcaagtctgcctacc
aagttcatgcccgcgcctggatattcggcgtacatcgcaccggataaatacgcgcaactc
ggccagctggtgtttggtggccatcttcccgacgacagccgccagcgattgttcgcaggg
gtcgacgatctgctggaccgactggacatgccgagatcgctgcgggaattcggggttgac
gagcagggattcctggccgcgctgccgacgctggcgatgaccgcgttcgaggacctcagc
aaccgcaccaacccgcggatgccgctggtcagcgagatcaccgatttgcttcggctgggc
tactacggtgacaccggcgttggggagccggccctggcgccgatcaagcccggggatgtt
gatggacggtccgtttag

DBGET integrated database retrieval system