KEGG   Mycobacterium liflandii: MULP_04756Help
Entry
MULP_04756        CDS       T02444                                 

Definition
magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mli  Mycobacterium liflandii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MULP_04756
Enzymes [BR:mli01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MULP_04756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5176861..5178255)
Genome map
AA seq 464 aa AA seqDB search
MVTSPSNLPRTVGELRASGHRERGVKQEIRENLLTALADGPDNAAVWPGIVGFDDTVIPQ
LERALIAGHDFVLLGERGQGKTRLLRALTGLLDEWTPLIAGAELPEHPYRPITPESIRRA
AQLKDDLPVAWKHRSERYTEKLATPDTSVADLVGDIDPIKVAEGRSLGDPETIAYGLIPR
AHRGIVAVNELPDLAERIQVSMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGR
IITPLKDRFGAEIRTHYPLELEAEMGVIAQEAHLSAQVPDYLLQVIARFARYLRESSSVD
QRSGVSARFAIAAAETAAAAARHRGAVLGETDPVARVVDLGTVIDVLRGKLEFESGEEGR
EQAVLEHLLRRATADTASRALGGIDVGTLVSAVEGGSAVTTGERVSAKDVLAAVPGLPVV
ETIARKLNAESEGERAAALELALEALYLAKRVDKVSGEGQTVYG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtggtgacttcaccgagcaatctgcctcgcaccgtcggcgagctgcgtgcctccggtcat
cgcgagcggggggttaagcaggaaatccgggagaatctgttgaccgcgctggccgatggg
ccggataacgcggccgtctggccgggcatcgtgggcttcgacgacaccgtgattccccag
ctcgagcgggccctgatcgcgggccacgattttgtgctgctgggcgagcgcggccaaggc
aagactcggctgctgcgcgcgctgaccggattgctcgacgagtggacaccgctgatcgcc
ggtgccgaacttcccgagcatccttaccggccgatcacgccggagtcgatccgccgggcc
gcgcagctaaaagacgatctgccggtggcatggaagcatcggagcgagcgttacaccgaa
aaactggccacccccgacaccagtgttgccgacctggtcggtgacatcgacccgatcaag
gtggccgagggtcgcagtctcggagaccccgaaaccatcgcctacgggctgattccgcgc
gcacaccgcggcatcgtggccgtcaacgagctgcccgacctggccgagcggatccaagtg
tccatgctcaatgtgatggaggagcgcgacatccaggtccgcggctacaccctgcgcctg
ccgctggacgtgttggtggtcgccagtgccaaccccgaggactacaccaaccgggggcgc
atcatcaccccgctcaaagacaggttcggcgccgagatccgcactcactacccgctggag
ctggaggcggagatgggtgtcatcgcgcaggaggcgcatctgagcgctcaggtgcccgat
tatctgttgcaggtgatcgcgcggttcgcccgctacctgcgcgagtccagttcggtcgac
cagcgctccggggtgtcggcgcgcttcgccatcgcggcggcggagaccgcggcggccgcc
gcccgccaccgcggggcggtgctgggcgagaccgacccggtcgcccgggtggtcgatctg
ggcaccgtgatcgacgtgctgcgcggcaagctcgagtttgagtccggtgaggaggggcgc
gagcaggcggtgctcgaacacctattgcgccgggccaccgcggataccgcgtcccgggcg
ctgggtggcatcgacgtcggcacactggtgtcagccgtcgagggaggttcggcggtgacg
accggtgagcgggtatcggccaaggatgtgctggcggccgttccgggactgccggtggtg
gagaccatcgcacgcaaactcaacgccgaatccgaaggggagcgggccgcagccctggag
ctggccctggaggcgctgtacctggccaagcgagtcgacaaagtgtccggggagggccaa
accgtttatggctga

DBGET integrated database retrieval system