KEGG   Mycobacterium liflandii: MULP_05274Help
Entry
MULP_05274        CDS       T02444                                 

Gene name
mhpF_1
Definition
acetaldehyde dehydrogenase, MhpF_1 (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mli  Mycobacterium liflandii
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mli00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mli00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:mli00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:mli00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:mli00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5692918..5693844)
Genome map
AA seq 308 aa AA seqDB search
MPSKASVAIVGSGNISTDLLYKLLRSDWLEPRWMVGIDPQSEGLARARKLGLETTHEGVD
WLLAQSDKPDLVFEATSAYVHKAAAPKYAAAGIRAIDLTPAAVGPAVVPPANLREHLDAP
NVNMITCGGQATIPIVYAVSRAVADLGGVPYAEIVASVASVSAGPGTRANIDEFTKTTSK
GVETIGGARRGKAIIILNPADPPMIMRDTIFCAIPEDADRDAIAASIHEVVAQVQTYVPG
YRLLNEPQFDEPSINSGGQAVVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKET
LAVSGGKR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcgaaggcaagtgtggccattgttgggtccggaaatatcagcaccgacctgctc
tacaaactgctgcgatccgactggctggaaccgcgctggatggtggggatcgacccgcag
agtgagggtttggcgcgggcccgcaagttgggcctggagaccacccacgagggcgtggat
tggctgttggcccagtcggacaagcccgatctggtgttcgaggcgaccagtgcctatgtg
cacaaggcggcggcgccgaagtatgcggccgccggaatccgggcgattgacttgacgccg
gcggcggtgggtcccgcggtggttccgccggccaacctgcgcgagcacctggatgccccc
aacgtcaacatgatcacctgtgggggacaggcgaccattccgatcgtgtacgcggtgtcg
cgagcggttgccgatctgggcggggttccctacgccgagatcgtggcgtcggtggcctcg
gtctcggcagggcccgggacccgggccaacatcgacgagttcaccaagaccaccagcaaa
ggtgtcgagacgatcggcggcgcccggcgcggtaaggcgatcatcattttgaacccggcc
gatccgccgatgatcatgcgggacacgatcttttgcgccatccccgaagacgccgaccgc
gacgcgatcgcggcctcgattcatgaggtcgtggcccaggtgcagacctatgtgcccggg
taccggttgctcaacgagccgcagttcgacgagccgtcgatcaactccggtggccaggcg
gtggtgaccacgttcgtcgaggtcgaaggcgctggcgattatctgccgccctatgcgggc
aatctggacatcatgaccgcggcggcgaccaaggtcggcgaggagatcgccaaggagacg
ctggccgtgtcaggaggaaagcgatga

DBGET integrated database retrieval system