KEGG   Mesorhizobium loti: mll0007Help
Entry
mll0007           CDS       T00043                                 

Definition
tyrosyl-tRNA synthetase (EC:6.1.1.1)
Orthology
K01866  
tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
mlo  Mesorhizobium loti
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    mll0007
Enzymes [BR:mlo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     mll0007
Amino acid related enzymes [BR:mlo01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   mll0007
Transfer RNA biogenesis [BR:mlo03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    mll0007
 Prokaryotic Type
    mll0007
Mitochondrial biogenesis [BR:mlo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    mll0007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(6203..7456)
Genome map
AA seq 417 aa AA seqDB search
MPAFKSDFLRTMSERGFIHQISDETGLDQLFAKETVTAYVGYDATATSLHIGNLISATML
YWLQETGHRPIALMGGGTSMIGDPSFRDDQRSLLTPEAIATNIEGIKRIFGRILRFGDGP
NDAIMVNNADWLMKLNYVEFLRDVGRHFSVNRMLTFDSVKLRLDREQSLSFLEFNYMILQ
GYDFVELARRQNCRLQMGGSDQWGNIINGVDLGHRMGTPQLYALTTPLLTTSSGAKMGKS
AKGAVWLNGDLFSPYDFWQYWRNTEDADVERFLKIFTRLPLPEIARLAALGGSEINEAKK
ILATETTAIVHGREAANQAEETARKTFEEGALADTLPTVGADKAALEAGIGILSLLVTAG
LASSNGEARRHIQGGAVRINDQSVSDDRRMVTLQDLSPENVVKLSLGKKKHVLVRPA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccttcaaatccgatttcctgcgcacgatgagcgagcgcggcttcatccaccag
atttcggatgagaccggcctcgaccagcttttcgccaaggaaacggtcaccgcctatgtc
ggctacgacgccaccgccaccagcctgcatatcggcaatctgatctcggcgaccatgctt
tactggctgcaggaaaccgggcaccggccgatcgcgctgatgggcggcggcacgtcgatg
atcggcgacccgtccttccgcgacgaccagcgcagccttttgacgcccgaggcgatcgcc
accaacatcgaaggcatcaagcgcattttcggccgcatcctgcgcttcggcgacggcccg
aacgacgccatcatggtcaacaatgccgactggctgatgaagctcaactatgtcgagttc
ctgcgcgatgtcggccggcatttttccgtcaaccgcatgctgaccttcgacagcgtcaag
ctcaggctcgaccgcgagcagtcgctgtcgttcctcgaattcaactacatgatcctgcag
ggctacgatttcgtcgagctcgcccggcgccagaactgccgcctgcagatgggcgggtcg
gaccagtggggcaatatcatcaacggcgtcgatctcggccatcgcatgggcacgccgcag
ctttacgcgctgaccacgccgctgctcacgacgtcgtcgggcgccaagatgggcaagtcg
gcgaagggtgcggtgtggctcaacggcgacctcttctcgccctatgatttctggcagtac
tggcgcaacaccgaggacgccgatgtcgagcgcttcctgaagatattcacccgcctgccg
ctgcccgaaatcgcgcgcctggccgcactcggcggctccgaaatcaacgaggccaagaag
atcctggccacggagacgacggcgatcgtccatggccgcgaagcggcaaaccaggccgag
gaaaccgcgcgcaagaccttcgaggaaggggcgctcgccgacacattgccgaccgtcggg
gccgacaaggcagcgctcgaagccggcatcggcatcctgtcgctgctggtcacggcgggg
ctggcatcgtccaatggcgaggcacggcggcacatacagggcggcgcggttcgcatcaac
gaccagtcggtcagcgacgaccgccgcatggtcacgcttcaggatctgagtccggaaaac
gtcgtcaagctttcactcggcaagaaaaagcacgttctggtgcggccggcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system