KEGG   Mesorhizobium loti: mll0412Help
Entry
mll0412           CDS       T00043                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mlo  Mesorhizobium loti
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mlo00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(297466..298398)
Genome map
AA seq 310 aa AA seqDB search
MTASPSFLGLPDRLDGRTPRAVIFGAGHGSTYPGKDSSGHALAADAIRAASQDDASLVEH
WDFDLGGPLFNGKPASCVDAGDISTILHDNAENRVRIEAKTREVLALPAVPILLGGDDSV
VIPFLAGFADHGPIWVLQIDAHIDWRDEVLGERHGYSSPMRRASEMPHVAGIVQVGLRSV
GSARLAEIEAARHYGSRFVTAREVHAQGVDAALRHIPEGARVVATFDCDSLDPGIMPGVA
ARTPGGLTYTQAIDLIAGLGKRARIAGFDLVELYPPADIDGLSALTAARLLVNVIGTIAS
MTVSQSSSTA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctcaccctcctttctcggccttcccgatcgcctggacggccgcacgccccgt
gcggtgatctttggggccggccacggcagcacctatcccggcaaggacagcagcggccat
gcgttggcggccgacgccattcgtgcggccagccaggatgatgcctcgcttgtcgagcac
tgggatttcgatctcggtggcccgttgttcaacggcaagccggcctcttgcgtcgacgcc
ggcgacatctcgaccatcctgcacgacaatgccgaaaacagggtccggatcgaagcgaag
acgcgcgaggtcctggccttgccggccgtgccgatcctgcttggcggtgacgattccgtc
gtcattccgttccttgccggctttgccgatcacggaccgatctgggtcctgcagatcgat
gcccatatcgactggcgcgacgaggtgcttggcgaacgccacggctattcgagcccgatg
cgaagggcaagcgagatgccgcatgtcgccggcatagtgcaggttggcctgcgcagcgtc
ggcagcgcgcgcctcgctgaaatcgaagccgcgcggcactatggcagccgtttcgtgaca
gcgcgcgaggttcatgctcaaggtgtggatgcagcgctcaggcatattccggaaggcgcg
cgggtcgtcgccaccttcgactgcgacagccttgatcccggcatcatgccgggcgtggcg
gcgcgtacgccgggcggcctcacctacacgcaagcgatcgacctgatcgccggcctcggc
aagcgggccaggatcgcgggattcgaccttgtcgagctctatccgcccgccgacatagac
ggcctgtcagcgctgaccgctgcgcgccttctcgtcaatgtgatcggcaccatcgccagc
atgacggtatcgcagtcgtccagcaccgcctga

DBGET integrated database retrieval system