KEGG   Mesorhizobium loti: mll0610Help
Entry
mll0610           CDS       T00043                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mlo  Mesorhizobium loti
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:mlo01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mlo01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mlo00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mlo00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mlo00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:mlo00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(476665..477435)
Genome map
AA seq 256 aa AA seqDB search
MTPGIRPLVAGNWKMNGTSASLNELRMIGNGFMSGLDAETEALVCVPATLLSHAAEILSR
TPVHAGGEDCHTKESGAYTGCISAEMLKDAGASHVIVGHSECREQRGEDDATVQAKAAAA
WRAGLVAIICIGETQQQREAGATLEVLSRQVAGSVPPSATPSNTVIAYEPVWAIGTGLTP
TAADVAEAHAHIRERLSEKLGASAAKTRILYGGSVKPSNAVELLGVRNVDGALVGGASLK
AADFLGIAEAYRSISG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacgccaggaattcgcccgcttgtcgccggcaactggaaaatgaacggcaccagcgct
tcgctgaacgagctcaggatgatcggcaacgggttcatgagcgggctcgacgcggagacc
gaggcgctggtctgcgttcccgcgacgctgctttcccatgcagccgagattctgtcgcgc
acgccggtccatgcgggcggcgaggattgccacaccaaggaaagcggcgcctacaccggc
tgtatctcggcggaaatgctgaaggacgccggcgcgagccatgttattgtcggccattcc
gaatgccgcgaacaacgcggcgaggacgatgcgacggtccaggccaaggccgccgccgca
tggcgcgccgggctcgtggccatcatttgcatcggcgagacgcagcagcagcgtgaggcg
ggcgccacgctcgaggtgctgtcgcgccaggtcgcaggttcggtgccgccgagtgccacg
ccatccaacaccgtcattgcctatgagccggtgtgggcgatcggcaccggcctgacgccg
accgcggccgatgtggccgaagcgcatgcgcatatccgcgaaaggctgtcggagaaactt
ggtgcctctgccgccaagacgcgcattctctacggtggctcggtcaagccgtccaacgcg
gtggaactgctgggcgtcaggaatgtcgatggcgcgctggttggcggcgccagcctgaaa
gcggccgatttcctcggtatcgccgaggcctatcgcagcatttcaggctga

DBGET integrated database retrieval system