KEGG   Mesorhizobium loti: mll0788Help
Entry
mll0788           CDS       T00043                                 

Definition
dihydroxypteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mlo  Mesorhizobium loti
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    mll0788
Enzymes [BR:mlo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     mll0788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(618020..618871)
Genome map
AA seq 283 aa AA seqDB search
MTARRWQLAHGRHLDLGGKAVVVGILNVTPDSFSDGGLFDAPEAALAQARRMIGEGAGII
DVGGESTRPGAAAISASEEQARVLPVIEALARSGDVLISVDTYRADTARLAVAAGAHIVN
DVWGLQREPDIARVAAETGAGLIIMHTGRDRKKLPDVIADQFAFLERSLEIARRNGIADD
RIVLDPGFGFAKETAEENLDLMARFSELHALGFPLMAGTSRKRFIGTVTGRDAADRAPGT
AATSVILRLKGAHLFRVHDVAINVDALAMADAMLARETAASER
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgaggcgatggcagctggcgcatggacgtcatctcgaccttggcggcaaggcc
gtggtcgtcggcattctcaacgtcacccccgacagcttttccgacggcggcctgttcgac
gcgcccgaagcggcgctggcccaggcgcggcgcatgatcggggaaggggcagggatcatc
gatgtcggtggagaatcgacacggccgggtgccgccgccatctcggccagcgaggaacag
gcgcgtgtcctgccggtgatcgaggcgctggcgcgctccggtgacgtgctgatttcggtc
gatacctatcgtgccgacaccgcgcggctggccgtggctgccggcgcgcatatcgtcaac
gatgtctggggcctgcagcgcgagcccgatatcgcgcgggtcgccgccgaaaccggagcc
gggctcatcatcatgcacaccggacgggatcgaaagaaactgcccgacgtgatcgccgac
cagtttgctttcctggaaagatcactggagatcgcccgccgcaacggcattgcggacgat
cgcatcgtgctcgatcccggtttcggcttcgccaaggagacggctgaggaaaatctcgac
ctgatggcgcggttttccgagctccatgcgcttggctttccgctgatggcaggcacttcg
cgaaaacgcttcatcggcaccgtcactggccgcgacgcggccgaccgggcccccggaacg
gcggcgaccagcgtcattctcaggctcaagggcgcgcatctgtttcgcgtccacgatgtc
gcaatcaacgtggacgctctggccatggcggatgctatgctggcgcgtgaaactgccgca
tcggaacgctga

DBGET integrated database retrieval system