KEGG   Mesorhizobium japonicum MAFF 303099: mll1048Help
Entry
mll1048           CDS       T00043                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    mll1048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: BAB48513
RhizoBase: mll1048
UniProt: Q98LF0
Position
complement(882060..882464)
Genome map
AA seq 134 aa AA seqDB search
MAIRGGNAMRALAFFAAVSVTIFIAHPSRAQDAAAGEKVFTKCQVCHIANEDKNKIGPSL
HGVIGRTAGTHPDFKYSDAMIAAGKSGVKWDEPTLTTYLHDPKAMVKGTKMTFPGLKNDA
DVANVIAYLKTFSK
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaggggaggaaatgccatgcgcgctctagcgtttttcgctgcggtgtccgtt
acgatcttcatcgcgcatccgtcgcgggcacaggatgccgcggctggtgagaaggtcttc
accaaatgccaagtctgccacatcgcaaacgaggacaagaacaagatcggcccgtcgctg
cacggcgtcatcggccgcacggccggtacgcatccggattttaaatattccgatgccatg
attgcggcaggcaaatccggcgtcaaatgggacgagccaacgctgacgacctaccttcac
gatcccaaggccatggtcaaaggcaccaagatgacgtttcccggtctcaagaacgatgca
gacgtggccaacgtcattgcctatctgaaaacgttctccaagtga

DBGET integrated database retrieval system