KEGG   Mesorhizobium loti: mll1048Help
Entry
mll1048           CDS       T00043                                 

Definition
cytochrome C
Orthology
K08738  
cytochrome c
Organism
mlo  Mesorhizobium loti
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    mll1048
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    mll1048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(882060..882464)
Genome map
AA seq 134 aa AA seqDB search
MAIRGGNAMRALAFFAAVSVTIFIAHPSRAQDAAAGEKVFTKCQVCHIANEDKNKIGPSL
HGVIGRTAGTHPDFKYSDAMIAAGKSGVKWDEPTLTTYLHDPKAMVKGTKMTFPGLKNDA
DVANVIAYLKTFSK
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaggggaggaaatgccatgcgcgctctagcgtttttcgctgcggtgtccgtt
acgatcttcatcgcgcatccgtcgcgggcacaggatgccgcggctggtgagaaggtcttc
accaaatgccaagtctgccacatcgcaaacgaggacaagaacaagatcggcccgtcgctg
cacggcgtcatcggccgcacggccggtacgcatccggattttaaatattccgatgccatg
attgcggcaggcaaatccggcgtcaaatgggacgagccaacgctgacgacctaccttcac
gatcccaaggccatggtcaaaggcaccaagatgacgtttcccggtctcaagaacgatgca
gacgtggccaacgtcattgcctatctgaaaacgttctccaagtga

DBGET integrated database retrieval system