KEGG   Mesorhizobium japonicum MAFF 303099: mll1078Help
Entry
mll1078           CDS       T00043                                 

Definition
(GenBank) L-isoaspartyl protein carboxyl methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Brite
Enzymes [BR:mlo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     mll1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 CMAS GCD14 Methyltransf_12 Methyltransf_32 PrmA MTS Methyltr_RsmB-F Methyltransf_4 Methyltransf_18 RrnaAD Cons_hypoth95
Motif
Other DBs
NCBI-ProteinID: BAB48533
RhizoBase: mll1078
UniProt: Q98LD0
Position
complement(903136..903789)
Genome map
AA seq 217 aa AA seqDB search
MNLPIDDREGFAAFLLRLRGRGTVPKALIAAFEATPRRGFLPAHFHQLAWSDRMLPIECG
EAIEGADMQAAVIAALAIEAGNRVLEIGTGSGYTAAVMSRLAARIVTIDRYKTLVEQARQ
RFEALGIGNVIVRQADGSGGLPAEGPFDRIVAWAAFDSLPRFLLDQLSSGGIVIAPIGPE
EGEQVLAKLTKVGSRFEREDIGLVRLQPILRSVAAVI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgccaatcgatgaccgcgaaggatttgccgctttcctgttgcgcctgcgcggc
aggggaaccgtgccgaaggcgctgatcgcggctttcgaggcaacaccgcggcgcggtttc
ctgccggcccacttccaccagctcgcctggtcagaccgcatgctgccgatcgaatgcggc
gaggcgatcgaaggtgccgacatgcaggcggcggtaatcgcggcccttgccatcgaagcg
ggaaaccgcgtgctcgagatcggcaccggctccggctatacggcggcggtgatgtcgcgg
ctggcggcgcggatcgtcaccatcgaccgctacaagaccctggtcgagcaggccaggcag
cgtttcgaggcgcttggcatcggcaatgtcatcgtgcgccaggctgacggctccggcggc
ctgcctgccgaaggcccgttcgaccgcatcgtcgcttgggccgccttcgacagcctgccg
cgcttcctgctcgaccaattgtcgagcggcggcatcgtcatcgcgccgatcgggccggaa
gagggcgagcaggttctggccaagctcaccaaggtcggcagccgtttcgagcgcgaggat
atcggcctcgtgcggctgcagccgatcctgcgcagcgtcgcggcggtcatctag

DBGET integrated database retrieval system