KEGG   Mesorhizobium japonicum MAFF 303099: mll1108Help
Entry
mll1108           CDS       T00043                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Brite
Enzymes [BR:mlo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     mll1108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 MTS Methyltransf_23 Methyltransf_32 Cons_hypoth95 Methyltransf_18
Motif
Other DBs
NCBI-ProteinID: BAB48556
RhizoBase: mll1108
UniProt: Q98LA7
Position
complement(930382..931050)
Genome map
AA seq 222 aa AA seqDB search
MSADFSELRVKMVDGQVRTTDVTSAPLLEAMLTVPREVFVGDRQRDLAYIDEDIRIADGA
DGARYLMEASPLAKLMQLAEINATDSALDVGCGTGYASAILSRLARSVVALESDSALAQT
ATSTLSGLGYGNVTVVQGALAQGHAAKAPYDVIFIGGSVEKVPAPLLDQLAEGGRLVAVE
GRGNSGVARLFFKAGGVVTGRRAFNAAIKPLPGFEREHAFEF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgatttctccgagcttcgcgtcaagatggtcgacggtcaggtgcgcaccacc
gacgtgaccagcgccccgctgctggaagccatgcttaccgtgccgcgcgaggttttcgtc
ggcgaccgccagcgtgatctcgcctatatcgacgaggacatccgcattgccgacggcgcc
gatggcgctcgctatctgatggaagcatcgccgctggccaagctgatgcaattggccgag
atcaatgcgaccgattcggcgctcgatgtcggctgtggcaccggctacgcctcggccatc
ctgtcgcgactggcgaggtcggtcgtggcgctcgaaagcgattcggcgctggcgcaaacc
gcgacatcgaccctttccggccttggctacggcaatgtgaccgtggtccagggcgcgctg
gcgcagggccatgcggccaaggcaccctatgacgtcatcttcatcggcggcagtgtcgag
aaagtgccggcgccgttgctcgatcagctcgccgaaggcggccgactcgtcgcggtcgaa
gggcgaggcaattccggcgtggcgcgactttttttcaaggctgggggggttgtaaccggg
agaagggcatttaatgcggcaattaagccactaccgggattcgaacgtgagcatgctttt
gaattctga

DBGET integrated database retrieval system