KEGG   Mesorhizobium loti: mll1167Help
Entry
mll1167           CDS       T00043                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
mlo  Mesorhizobium loti
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mll1167
   00052 Galactose metabolism
    mll1167
Enzymes [BR:mlo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     mll1167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(977754..978776)
Genome map
AA seq 340 aa AA seqDB search
MTMKDGEVFGTTQAGEPVRRFTIKGGGLTANIIGLGAIIQDLRLTGHDAPLVLGYNTLEA
YEADNAFFGAVVGRYANRIRDGRFTIGGNRYQTERNFLGKHTLHGGSQGYSHRPWAVSLH
GRDFVTLTLHDPDGAMGFPGALDVTCTYRLKIPGTLSVELTATCEEPTLCNLTQHSYFNL
DDGGAGDILDHRMMLNAGAYLPVDSDMIPTGVVKPVDGTPFDFRQARPLRMETEGEQLPY
DQNFCLASARGPLRQAAWTQGASSGVEMEVWTTEPGVQLYTGQYVTPRKGLDGRDYKAFS
AFCLEPQIWPDAPNRPYFPQATLWPGAIYHHVTEYRFRLP
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgaaggacggcgaggtttttggcacgacgcaggcgggcgagccggtgcgccgc
ttcaccatcaagggcggcggcctcaccgccaacatcatcgggctcggcgcgatcatccag
gatttgcgcctgaccggtcacgatgcgccgctggtgctcggctataacactctggaagcc
tacgaagccgacaacgccttctttggcgcggtggtcggccgctacgccaaccgcatccgc
gacggccgcttcaccatcggtggcaaccgctaccagaccgagcgaaatttcctcggcaag
catacgctgcatggcggctcacagggctattcgcatcggccgtgggcggtttcgctgcat
ggccgggacttcgtcacgctgacgctgcacgatcccgacggagcgatgggctttcccggc
gcgctcgacgtcacctgcacctaccggctgaagatccccggtacgctgagcgtcgagctg
actgcgacctgcgaggagccgacgctgtgcaatctcacccagcactcctatttcaacctg
gacgacggcggcgccggcgacattctcgaccacaggatgatgctgaacgccggcgcctat
ctgccggtcgacagcgacatgatcccgaccggcgtggtcaagccggtcgacggcacgccc
ttcgatttccgccaggcgcggccgctgcgcatggaaaccgagggcgagcagctgccctac
gaccagaacttctgcctcgcctcggcgcgcgggccgctgcggcaagcggcatggacgcaa
ggggcgagttccggcgtcgagatggaggtctggaccacggagccaggcgtccagctctac
accggccagtatgtgacgccgcgcaaggggctggacgggcgggactacaaggccttttcc
gccttctgcctggagccgcagatctggccggatgcgccgaaccggccgtatttcccgcag
gcgacgctatggccgggtgcaatttatcaccatgtgacggaataccgtttccgcctgcct
tga

DBGET integrated database retrieval system