KEGG   Mesorhizobium loti: mll2628Help
Entry
mll2628           CDS       T00043                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mlo  Mesorhizobium loti
Brite
Enzymes [BR:mlo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     mll2628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2126259..2126984)
Genome map
AA seq 241 aa AA seqDB search
MVANRGEDPKFLAQRFDRFQIMVYNKDVLDDRNKRAFLLTPREEFVLPQNLGRAYDHAFL
DIGYGVTISGPHLVGRMTTAIDVQFGEAVLEIGTGSGYQSAYLANLTDKVHTIEIINPLA
QRTRRTYDGLVERGYSEFGSVTSRNADGYYGWESVGPFDKIIVTCGIDHIPPSLLQQLKP
NGVMVIPVGPPGAQHVLKVTKQQLADGTFNIVRSDIYNGKVVPFVPFTKLEGDQIVGTHN
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggtggccaatcgcggcgaggatccgaagtttttggcgcagcgattcgatcgcttccag
atcatggtctacaacaaggacgtgctggacgaccgcaacaagcgcgccttccttttgact
ccgcgtgaggaattcgtgctgccgcagaatctggggcgcgcctacgaccatgccttcctc
gacatcggctatggcgtgacgatttcgggtccgcacctggtcgggcggatgacgacggcg
atcgacgtgcaattcggcgaggccgtactcgagatcggcaccggttcgggttaccagtcg
gcctatctcgccaacctcaccgacaaggtgcacacgatcgagatcatcaatccgctggcg
cagcgcacgcggcgcacctatgacgggctggtcgagcgcggctacagcgaattcggttcg
gtcaccagccgcaatgccgacggctattatggctgggaaagcgtcggcccgttcgacaag
atcatcgtcacctgcggcatcgaccacattccgccgtcgctgctgcagcagttgaagccc
aatggcgtgatggtcattccggtcggcccgccgggcgcgcagcacgtgctcaaggtgacc
aagcagcagctcgcggacggcacgttcaacatcgtccgctcggacatctacaatggcaag
gtggtgccgttcgtgccgttcaccaagctggaaggcgaccagatcgtcggcacgcacaac
agctga

  All links  
No link information was found.   
DBGET integrated database retrieval system