KEGG   Mesorhizobium loti: mll3025Help
Entry
mll3025           CDS       T00043                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mlo  Mesorhizobium loti
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    mll3025
   00052 Galactose metabolism
    mll3025
   00500 Starch and sucrose metabolism
    mll3025
   00520 Amino sugar and nucleotide sugar metabolism
    mll3025
Enzymes [BR:mlo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     mll3025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2429646..2430551)
Genome map
AA seq 301 aa AA seqDB search
MKRVRKAVFPVAGLGTRFLPATKAVPKEMLTVVDRPVIQYVVDEAREAGIEHFIFVTGRN
KAVIEDHFDIQFELYDTLAQRGKDEQLARLQRLQPAPGQTSFTRQQVPMGLGHAVWCARE
LVGDEPFALLLPDMIMQSEKSCMKSMVELYEETGNNIIAVQECDPAEAHKYGIVGRGEDT
HHGFRITEMVEKPKTGTAPSNLYINGRYILQPEIFKILEGQEKGAGNEIQLTDAMLKLEK
QQAFYGYHYQGRTFDCGSPEGFVEANVAFALWRSDMKENMAGVIRTLLDEMTPSERRVAV
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagttcgcaaggcagttttcccggtcgccggtctcggcacgcggttcctcccg
gccaccaaggctgttcccaaggaaatgctgaccgtcgtcgaccggccggtcatccaatat
gtggtggacgaggcgcgcgaggcgggcatcgagcatttcatcttcgtgaccggccgcaac
aaggcggtcatcgaggaccatttcgatatccagttcgagctctatgacacgcttgcccag
cgcggcaaggacgagcagctggcccgcctgcagcggctgcagccggcgccggggcagacc
agtttcacccgccagcaggtgccgatgggccttggccacgccgtctggtgcgcccgcgaa
ctggtcggcgacgagccgttcgcgctgctcttgcccgacatgatcatgcagtcggaaaag
agctgcatgaagtcgatggtcgagctctacgaggaaaccggcaacaacatcattgccgta
caggaatgcgacccggcagaggcccacaaatatggcatcgtcggccgtggcgaggatacg
catcacggcttccgcatcaccgagatggtggagaagccgaaaaccggcacagcaccctcc
aacctctacatcaacggccgctatatcctgcagcccgagatcttcaagatcctcgaaggc
caggaaaagggcgccggcaacgaaatccagctcaccgacgcgatgctgaagctggagaag
cagcaggccttctacggctaccactatcagggccgcaccttcgactgcggttccccggaa
ggtttcgtcgaggccaatgtcgccttcgcgctgtggcgcagcgacatgaaggagaacatg
gccggcgtcatccgcacgcttcttgacgagatgacgccatcggagcggcgagtcgcggta
tcttag

DBGET integrated database retrieval system