KEGG   Mesorhizobium japonicum MAFF 303099: mll3627Help
Entry
mll3627           CDS       T00043                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase homoserine dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00010  Glycolysis / Gluconeogenesis
mlo00020  Citrate cycle (TCA cycle)
mlo00620  Pyruvate metabolism
mlo01100  Metabolic pathways
mlo01110  Biosynthesis of secondary metabolites
mlo01120  Microbial metabolism in diverse environments
mlo01130  Biosynthesis of antibiotics
mlo01200  Carbon metabolism
Module
mlo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mll3627
   00020 Citrate cycle (TCA cycle)
    mll3627
   00620 Pyruvate metabolism
    mll3627
Enzymes [BR:mlo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     mll3627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: BAB50482
RhizoBase: mll3627
UniProt: Q98FT5
Position
complement(2924456..2925820)
Genome map
AA seq 454 aa AA seqDB search
MPTEVILPKVDMDMATGQISRWFAEEGARVKKGDVLFEIETDKAAMEIDAPASGVLRDVS
GKEGVDIPVGAPVAWIYADDEAYGAKQDAAPISPLVGEMSAKSTEGDVVPPTSHSVMPPS
ALPGISPTRGEIGQSPPGERATPLARRLAREAGLALAGIIGTGPHGRVVKADVDAAIAGG
GAKAAPAAKAPAGAPAAAPAPAVKPMSDDQVLKLFEQGSYELVPHDNMRKTIARRLVEAK
STIPHFYLTLDCELDALLALRTQINAAAPMKKTEKGDVPAYKLSVNDMVIKAMAMALKAV
PDANASWTETAMVKHKHADVGVAVSIPGGLITPIIRHADEKTLSTISNEMKDLASRARSR
KLKPEEYQGGTTAVSNLGMFGIKDFAAVINPPHATILAVGAGEERAVVKNGEIKIATVMS
VTLSTDHRAVDGALGAELLVAFKRLIENPMGMLV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgaagtcattctccccaaggtcgatatggacatggcgaccggacagatctcg
cgctggttcgccgaagaaggtgcccgggtcaagaagggcgatgtgctgttcgagatcgag
accgacaaggcggccatggagatcgatgcgccggccagcggcgtgctgcgcgacgtctca
ggcaaggaaggcgtcgacattcccgtcggcgcgccggttgcgtggatttacgccgacgat
gaggcttatggggccaagcaagacgcggcgccaatctccccccttgtgggggagatgtcg
gcgaagtcgacagagggggacgtcgtcccaccaacgtcgcattctgtcatgcccccctct
gccctgccgggcatctcccccacaaggggggagattggccaatcaccgccaggcgaacgc
gcgacaccgcttgcccgacgtctggctcgtgaggcaggtcttgcccttgccggcatcatc
ggcaccggcccgcatggccgtgtggtgaaggccgatgtcgatgcagcgattgccggcggt
ggtgccaaggcagcgcccgccgccaaggctccggccggtgcgccggctgccgctcccgcg
ccggctgtgaagccgatgtcggacgaccaagtgctgaagctgttcgagcaaggctcctac
gaactcgtcccgcacgacaatatgcgcaagaccatcgcgcgccgcctggtcgaggccaag
tccaccatcccgcatttttatctaacgctcgactgcgaactcgatgcgttgctggccttg
cgcacgcagatcaatgccgccgcaccgatgaagaagaccgaaaagggtgacgtgcctgcc
tacaagctgtcggtcaacgacatggtgatcaaggcgatggcgatggcgctgaaggcggtg
ccggatgccaatgcctcgtggaccgaaaccgccatggtcaagcacaagcatgccgatgtc
ggcgtcgccgtgtcgatccccggcggcctgatcacgccgatcattcggcatgcggacgaa
aaaacgctgtcgaccatttccaacgagatgaaggacctggccagccgtgcccgcagccgc
aagctgaagccggaagagtatcagggcggcacgacggcggtctccaacctcggcatgttc
ggcatcaaggacttcgccgccgtcatcaatccgccgcatgcgacgatcctggcggtcggc
gccggtgaagagcgggctgtggtcaagaatggcgagatcaaaatcgccaccgtgatgtcg
gtgacgctgtcgaccgatcatcgcgccgttgatggcgcgctcggcgccgaattgttggtc
gccttcaagcggctgatcgagaacccgatgggcatgctggtgtag

DBGET integrated database retrieval system