KEGG   Mesorhizobium loti: mll3632Help
Entry
mll3632           CDS       T00043                                 

Definition
D-beta-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mlo  Mesorhizobium loti
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mlo00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:mlo00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(2930319..2931107)
Genome map
AA seq 262 aa AA seqDB search
MGSLSSKNALVTGSTSGIGLAIARAFAAEGANVTINGLGDPAAIEQERAGIEKDFGVKCR
YSDANMMDGAAVSAMVHDAEAAFGSLDILVNNAGIQHVAPIEEFPDDKWEAIIRINLLAA
FYAIKAAVPGMKARKWGRIINTASAHALVASPFKSAYVSAKHGIAGLTKTVALEVAQDGI
TVNAIAPGYVWTPLVEKQIPDTMKARGMTEEQVKHDVLLAAQPTKEFVTVEELAALTLFL
CSDAARQITGTTLPMDGGWTAQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttccctgtcttcgaagaatgccctcgtcaccggctcgaccagtggtatcggcctg
gccatcgcccgcgccttcgccgccgagggcgccaatgtcaccatcaacggtctcggcgat
ccggcggccatcgagcaggagcgcgcgggcatcgagaaggatttcggcgtcaagtgccgc
tactccgacgccaacatgatggatggcgccgcggtcagcgccatggtgcatgacgccgag
gctgcattcggcagcctcgacatcctggtcaacaatgccggcatccagcatgtcgcgccg
atcgaggagtttcccgacgacaaatgggaagccatcatccgcatcaatcttctggcggcc
ttctatgccatcaaggcggcggtgcctgggatgaaggcgcgcaaatggggccgcatcatc
aacacggcctcggcccacgcgctggtcgcctcgccgttcaagtcggcctacgtctcggcc
aagcacggcattgcagggttgaccaagacggtggcgctggaagtggcgcaggacggcatc
accgtcaacgctatcgcgcccggctatgtctggacgccgctggtcgagaaacagatcccc
gacacgatgaaggcgcgcggcatgaccgaggaacaggtcaagcatgacgtgctgctcgcc
gcacagccgacgaaggaattcgtcaccgtggaggaacttgcggcgttgacactgttcctg
tgctcagatgcggccaggcagatcaccggcacgaccttgccgatggacggcggctggacg
gcgcagtag

DBGET integrated database retrieval system