KEGG   Mesorhizobium loti: mll3898Help
Entry
mll3898           CDS       T00043                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mlo  Mesorhizobium loti
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    mll3898 (ruvA)
Enzymes [BR:mlo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     mll3898 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3133447..3134067)
Genome map
AA seq 206 aa AA seqDB search
MIGKLKGTLDEIDEDHCLVDIHGVGYVAYCSARTLAALPSPGEAVVLFIETYVREDMLRL
YGFQSALEREWFRLLLNNVPGVGAKVALAILSTLAPADLANAIALRDIAMVSRAPGVGKK
VAERIVTELKNKAPAYAGAASGTIGLKQELGEGVAPAPITDAVSALVNLGYSRDTAANAV
AAALKTAGEDADASKLIRFGLKELAR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaagctcaagggcacgctcgacgagatcgacgaggatcattgcctcgtcgac
attcatggcgtcggctatgtcgcctattgttcggcgcgcacacttgccgcgctgccttcg
cccggcgaggcggtggtgctgttcatcgagacctatgtgcgcgaggatatgctgcgcctc
tatggtttccagtcggccctggagcgcgaatggtttcggttgctgctgaacaatgtgccg
ggtgtcggcgccaaggtggcgctggccatcctgtcgacgctggcgccggccgacctcgcc
aatgcgatcgcgctgcgcgacatcgccatggtcagccgagccccaggcgtcggcaagaag
gtggctgagcgcatcgtcaccgaattgaagaacaaggcgccggcctatgcgggcgccgcc
tccggcaccatcggcctgaagcaggagctcggtgaaggagtggcgcccgcgccgatcacc
gatgcggtttcggcactggtcaatctcggctattcgcgcgacaccgccgccaatgcggtg
gccgcggcactgaagacggcgggcgaggacgcggatgcctcgaagctgatccgcttcggg
ctgaaggaactggcgcggtga

DBGET integrated database retrieval system