KEGG   Mesorhizobium loti: mll4265Help
Entry
mll4265           CDS       T00043                                 

Definition
succinate dehydrogenase cytochrome b small subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mlo  Mesorhizobium loti
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    mll4265
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    mll4265
   00650 Butanoate metabolism
    mll4265
  Energy metabolism
   00190 Oxidative phosphorylation
    mll4265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3401026..3401424)
Genome map
AA seq 132 aa AA seqDB search
MSGKNSTDMRTPLAKVRGLGSAREGTGHFWRQRLTAIANIPLTLFFVGFLIALNGAGYAE
VRAALANPFVGLMLALVLISGLIHMRLGMQVIIEDYITSEGLKLATIALNTFFTVAVGVA
SIFALLKLAFGG
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcaagaacagtaccgacatgcgcacgccgctggcgaaagtccgcggactcggc
tccgcccgcgagggcaccggccatttctggcgccagcgcctgaccgccatcgccaacatc
ccgctgacgctgttcttcgtcgggttcctgatcgcgctcaacggcgccggctatgcggaa
gtgcgcgcggcgctcgccaatccgttcgtggggctgatgctggccctggtgctgatctcc
gggctcatccatatgcggctcggcatgcaggtgatcatcgaggattacatcaccagcgaa
ggcctgaagctggcgacgatcgcgctcaacacatttttcactgtagcggtcggcgtcgcc
tcgatcttcgccctgctcaagctggcattcggaggctga

DBGET integrated database retrieval system