KEGG   Mesorhizobium japonicum MAFF 303099: mll4300Help
Entry
mll4300           CDS       T00043                                 

Definition
(GenBank) dihydrolipoamide succinyl transferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00020  Citrate cycle (TCA cycle)
mlo00310  Lysine degradation
mlo01100  Metabolic pathways
mlo01110  Biosynthesis of secondary metabolites
mlo01120  Microbial metabolism in diverse environments
mlo01130  Biosynthesis of antibiotics
mlo01200  Carbon metabolism
Module
mlo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mlo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    mll4300
  Amino acid metabolism
   00310 Lysine degradation
    mll4300
Enzymes [BR:mlo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     mll4300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: BAB50989
RhizoBase: mll4300
UniProt: Q98ED1
Position
complement(3422203..3423477)
Genome map
AA seq 424 aa AA seqDB search
MATEIRVPTLGESVTEATIGKWFKKVGDAIAVDEPLVELETDKVTVEVPAAAAGTLGEIV
AKEGETVGVGALLGSISAGGSAPATKPQAVSQASSPDAASTSKQAAAETAKIAGDAGAVE
PRSMPPAPAAAKLIAENNLSVDQLSGSGKRGQVLKGDVLDAIAKGAPSQPAETPRAAPAP
IAVRAPSSGDDASREERVRMTKLRQTIARRLKEAQSTAAMLTTFNEVDMSAVMALRTKYK
DVFEKKHGVKLGFMGFFTKAVTHALKEIPAVNAEIDGTDIIYKNFAHVGVAVGTEKGLVV
PVVRDADQMSIAEIEKEIGRLGIAARDGKLSVADMQGGTFTISNGGVYGSLMSTPILNAP
QSGILGMHKIQDRPVVVGGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERL
VLDL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgaaatccgcgttcccactctcggcgaatccgtcaccgaggcgaccatcggc
aaatggttcaagaaggtcggcgatgccattgccgtcgacgagccgctggtcgagctcgaa
accgacaaggtgacggtggaagttccggccgccgccgccggcacgctgggcgaaatcgtc
gccaaggaaggcgagacggtcggtgtcggcgctttgttgggctcgatctcggctggtggc
tctgcgccggcgaccaagccgcaggcggtgtcgcaggcctcgtcgcctgatgcggcgtcg
accagcaagcaggccgcggccgagaccgccaagatcgccggcgatgccggcgcggtcgag
ccgcgcagcatgccgccggcgccggctgcggcaaaactgatcgccgagaacaatctgtcg
gttgaccagctttccggctcgggcaagcgcggccaggtgctgaagggcgacgtgctcgac
gccatcgccaagggcgcgccgtcgcagccggccgagacgccgagggctgcgccggcaccg
atcgcggtgcgtgcgccatcctccggcgacgatgcttcgcgggaagaacgcgtgcgcatg
accaaattgcgccagaccatcgcgcgccggctgaaggaagcgcagtcgaccgccgccatg
ctgacgaccttcaacgaggtcgacatgtcggcggtgatggcgctgcggaccaagtacaag
gacgtgttcgagaagaagcatggcgtgaagctcggcttcatgggcttcttcaccaaggcc
gtcacccatgcgttgaaggaaatcccggcggttaatgccgagatcgatggcaccgacatc
atctacaagaactttgcccatgtcggcgtcgccgtcggcaccgagaagggcctggtcgtg
ccggtcgtgcgcgatgccgaccagatgtcgatcgccgagatcgagaaggagatcggccgg
ctcggcatcgccgcgcgcgacggcaagctgtcggtcgccgacatgcagggcggcacgttc
acgatttccaatggcggcgtctacggttcgctgatgtcgacgccgatcctcaacgcgccg
cagtcgggcattctgggcatgcacaagatccaggaccggcctgtcgtggttggcggccag
atcgtgatccggccgatgatgtatctggcgctcagctacgatcaccgcatcgtcgacggc
aaggaagccgtgaccttcctggtgcgcgtcaaggaaagcctggaggatccggaacggctg
gtgctcgatctctag

DBGET integrated database retrieval system