KEGG   Mesorhizobium loti MAFF303099: mll4303Help
Entry
mll4303           CDS       T00043                                 

Definition
(GenBank) succinyl-CoA synthetase alpha-subunit
  KO
K01902  
succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
mlo  Mesorhizobium loti MAFF303099
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    mll4303
   00640 Propanoate metabolism
    mll4303
   00660 C5-Branched dibasic acid metabolism
    mll4303
Enzymes [BR:mlo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     mll4303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
complement(3427332..3428234)
Genome map
AA seq 300 aa AA seqDB search
MSILVDKNTKVLVQGLTGKTGTFHTEQALAYHGTKMVGGIHPKKGGETWTGSKGESLPIF
ATVAEGKAKTGANASVVYVPPAGAAEAILEAIEAEIPLIICITEGIPVMDMVKVKARLDR
STSRLIGPNCPGVLTPDECKIGIMPGNIFRKGSVGVVSRSGTLTYEAVFQTTNVGLGQTT
AVGIGGDPVKGTEFIDVLEMFLADDETKSIIMIGEIGGSAEEDAAQFLKDEAKRGRKKPM
AGFIAGRTAPAGRTMGHAGAVISGGKGGAEDKIAAMESAGIKVSPSPARLGTTLVEAIKG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtccattctcgtcgacaagaacaccaaggtgctggtgcagggcctgaccggcaagacc
ggtacgttccacaccgaacaggcgctggcctatcacggcaccaagatggtgggtggcatc
catcccaagaagggcggcgagacgtggaccggctcgaagggcgagagcctgccgatcttc
gccaccgtcgccgaaggtaaggcaaagaccggggccaacgcctccgtcgtttacgtgccg
ccggcaggtgccgccgaagcgatcctggaagcgatcgaggccgagatcccgctgatcatc
tgcatcaccgaaggcattccggtgatggacatggtcaaggtcaaggcgcggctcgaccgc
tcgacctcgcggctgatcggcccgaactgcccgggcgttctcacccccgacgaatgcaag
atcggcatcatgcctggaaacatcttccgcaagggctcggtcggcgttgtttcgcgctcg
ggaacacttacctatgaggccgtgttccaaaccaccaatgtcggcctcggccagaccacc
gccgtcggcatcggtggcgacccggtcaagggcaccgagttcatcgacgtgctcgagatg
ttcctggccgacgatgagaccaagtcgatcatcatgatcggcgagatcggcggttcggcc
gaggaagacgccgcgcagttcctcaaggacgaagccaagcgtggccgcaagaagccgatg
gccggcttcatcgccgggcgcacggcgccggccggccgcacgatgggccatgccggcgcg
gtcatctccggcggcaaaggcggcgccgaggacaagatcgcggcgatggaatcggccggc
atcaaggtctcgccgtcaccggcgcggctgggaacgacgctggtcgaggcgatcaaggga
taa

DBGET integrated database retrieval system