KEGG   Mesorhizobium loti: mll5025Help
Entry
mll5025           CDS       T00043                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mlo  Mesorhizobium loti
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    mll5025
   01230 Biosynthesis of amino acids
    mll5025
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mll5025
   00030 Pentose phosphate pathway
    mll5025
   00051 Fructose and mannose metabolism
    mll5025
   00052 Galactose metabolism
    mll5025
  Energy metabolism
   00680 Methane metabolism
    mll5025
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    mll5025
Enzymes [BR:mlo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     mll5025
Protein phosphatases and associated proteins [BR:mlo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     mll5025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(3978826..3979992)
Genome map
AA seq 388 aa AA seqDB search
MAGTFIIAQGGGPTAVINQTVVGATLEIRKRHPGAKVLGSIHGVRGIRDGNYVDLSAIPE
DRLRLIAGTPSAALGSTRDKPDAAYCDVILKGLKKAGADAFIYIGGNDTSGTQQILTDAA
GGSIAFVHAPKTIDNDLEENDHTPGFISAAEFVAGAFLSVDLDFRALPGIYVGIVMGRHA
GFLTAAAAAWQLDPDSGPHLVYVPERPFSAAGFIDDVRATLDRHKRCIVAVSEGVSTADG
KALVESLVPPEKLERDAHGNVKLSGSDLPAALERALAEGLPGKRARVDALGYMPRGYVGA
ISAVDAQEAFDAGAFAVSVAEQGGGSVALQYDGTKTVLKKVPLKNVAGKTRHMPDDFMKP
DVNQLSEAGMAYLKRLVPEKYKVGKPFV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggccggaacttttatcatcgcgcagggcggcggcccgaccgccgtcatcaaccagacg
gtggtcggcgccacgctggagatccgcaagcggcatccgggcgccaaggtcctgggctcc
atccatggcgtgcgcggcatccgcgacggcaattatgtcgacctctcggccatccccgag
gatcggctgcggctgatagcgggaacgccaagcgccgcccttggctcgacgcgcgacaag
ccggatgccgcctattgcgacgtcatcctcaaaggcctgaagaaggccggcgccgacgcc
ttcatctatatcggcggcaacgacacgtcgggcacgcagcagatcctgaccgatgccgcc
ggcggctcgattgctttcgtccatgcacccaagaccatcgacaatgatctggaggagaac
gaccacacgccgggcttcatctcggcggccgagttcgtcgccggcgccttcctctccgtc
gatctcgatttccgcgctttgcctggcatctatgtcggcatcgtcatgggccggcatgcc
ggttttctcaccgcggcggcggccgcctggcagctcgatcccgacagcggcccgcatctg
gtctatgtgccggagcggccgttctcggccgccggcttcatcgatgatgtgcgcgccacg
cttgaccggcacaagcgctgcatcgtcgccgtgtcggaaggggtaagcaccgccgacggc
aaggcgctggtcgaaagcctggtgccgccggagaagctcgagcgtgacgcccatggtaac
gtcaagctgtcgggcagcgacctgccagccgcgcttgagcgcgcgctggccgaaggcctg
cccggcaagcgggcccgcgtcgacgcgctcggctacatgccgcgcggctatgtcggcgcc
atcagcgccgtcgacgcgcaggaggcgttcgatgccggcgccttcgccgtctccgtcgcc
gaacagggcggcggctcggtggcgctgcagtatgacgggacaaagacggtgctgaaaaag
gtgccgctgaagaatgtcgccggcaagacccgccacatgcctgacgatttcatgaagccc
gacgtcaaccagctgtccgaagccggcatggcctatctcaagcggctggtgccggaaaag
tacaaggtcgggaagcctttcgtttaa

DBGET integrated database retrieval system