KEGG   Mesorhizobium japonicum MAFF 303099: mll6527Help
Entry
mll6527           CDS       T00043                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00630  Glyoxylate and dicarboxylate metabolism
mlo01100  Metabolic pathways
mlo01110  Biosynthesis of secondary metabolites
mlo01120  Microbial metabolism in diverse environments
mlo01200  Carbon metabolism
Module
mlo_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    mll6527
Enzymes [BR:mlo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     mll6527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: BAB52803
RhizoBase: mll6527
UniProt: Q988Z4
Position
complement(5333133..5334422)
Genome map
AA seq 429 aa AA seqDB search
MTDFYNLVPSAPEGRFDGIERPYSPEDVKRLRGSVQIRQSLAEMGANRLWKLIHEEDFVN
ALGAMSGNQAMQQVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAAPELVKRINRT
LQRADQIETSEGNGLSVETWFAPIVADAEAGFGGPLNAFEIMKAFIEAGAAGVHYEDQLA
SEKKCGHLGGKVLIPTAAHIRNLNAARLAADVMGTPTLVVARTDAEAAKLLTSDIDERDQ
PFVDYDAGRTVEGFYQVRNGIEPCIARAVAYAPHADLIWCETSKPDLAQAKKFAEGVRRH
HPGKLLAYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHQLNYGMFELARG
YKERQMAAYSELQEAEFAAEANGYTATKHQREVGTGYFDAVSMAITGGKSSTTAMHESTE
HAQFRPAAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttttacaatctcgttccctcggcgccggaaggtcgcttcgacggtatcgaa
cgtccctattcgccagaggatgtgaaacggctgcgcggctcggtgcagatccgccagagt
ctcgccgaaatgggtgccaaccggctgtggaagctcatccacgaggaggatttcgtcaac
gcgctcggcgccatgtccggcaaccaggcgatgcagcaggtgcgcgccggactgaaggcg
atctatttgtcgggctggcaggtcgccgccgacgccaacactgcctcggcgatgtatccc
gaccagtcgctttatccggccaatgccgcgccggagctggtcaagcgcatcaaccggacg
ctgcagcgtgccgaccagatcgagacctccgagggcaatgggctttcggtcgagacctgg
ttcgcgccaatcgttgccgatgccgaagccggcttcggcgggccgctcaacgccttcgag
atcatgaaggcgttcatcgaagcgggcgccgccggcgttcactacgaggatcagctggcg
tcggaaaagaagtgcggccatctcggcggcaaggtgctgatcccgaccgccgcgcatatc
cgcaacctcaacgccgcgcgcctggcagcggatgtgatgggcacgccgacgctggtcgtg
gcacgcaccgacgccgaagccgcgaagcttctgacatccgacatcgacgagcgcgaccag
cccttcgtcgactacgatgccgggcgcacggtggaaggcttctaccaggtcaggaacggc
atcgagccctgcatcgcgcgggccgtcgcctatgcacctcacgcggacctgatctggtgc
gagacctcgaagccggacctggcacaggccaaaaaattcgccgagggcgtgcgcaggcac
catccgggcaagctgctcgcctataattgctcgccctcgttcaactggaagaagaatctc
gacgacgcgacgatcgccaaattccagagggaactcggcgccatgggctacaagttccag
ttcatcacgctcgccggcttccaccagctcaactacggcatgttcgaactggcgcgtggc
tacaaggaacggcagatggccgcctattccgagttgcaggaagccgaattcgcggcggag
gccaatggctacaccgcgaccaagcaccagcgcgaggtcggcaccggctatttcgacgcc
gtgtcgatggcaatcaccggcggcaagtcgtcgaccaccgccatgcatgaatcgaccgag
cacgcacagttcagaccagccgcggaatag

DBGET integrated database retrieval system