KEGG   Mesorhizobium japonicum MAFF 303099: mll6778Help
Entry
mll6778           CDS       T00043                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00220  Arginine biosynthesis
mlo00330  Arginine and proline metabolism
mlo01100  Metabolic pathways
mlo01110  Biosynthesis of secondary metabolites
mlo01130  Biosynthesis of antibiotics
mlo01230  Biosynthesis of amino acids
Module
mlo_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    mll6778
   00330 Arginine and proline metabolism
    mll6778
Enzymes [BR:mlo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     mll6778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: BAB53009
RhizoBase: mll6778
UniProt: Q988E1
Position
complement(5579796..5580728)
Genome map
AA seq 310 aa AA seqDB search
MRCKIVGAPVQDGAGRMGCEMGPSALRTAGLAEVLSGLGHTVEDMGAVQPMPARRVVHGN
LALKALPEISAWTSAIAAAAYAASEDAMPIFLGGDHSISAGTVSGLARRAAEAGRPLFVL
WLDAHPDFHTLDTTASGNLHGVPLAYASGQPGFSGYFPDLPAAVDPKRICTMGLRSVDPA
ERSALNQAGVTVHDMRAIDEHGIAPLLRAFLARVSDEDGLLHVSLDVDFLDPSIAPAVGT
TVPGGATFREAHLVMEMLSDSGLVSSLDLVELNPFLDERGRTATLMVDLTASLMGRRIMD
RPTRSHSGSF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgcaaaatcgtcggggcaccggtgcaggacggcgccggcagaatgggctgcgaa
atggggccgagtgcgctgaggacggcagggcttgccgaagtgctgtccggcctcggccac
actgtcgaggatatgggcgccgtccagccaatgccggcgaggcgcgtcgtgcacggcaat
ctggcgctgaaggccttgcccgaaatatcggcctggacatccgccatcgcagcggcagct
tacgcagcgagcgaggatgccatgccgattttccttggcggtgaccattcgatctcggcg
ggaaccgtgtcgggcctcgcccgccgcgccgccgaggccgggcgcccgctgttcgtgctg
tggctcgatgcgcatccggacttccacacgctggacaccaccgccagcggcaatctgcac
ggtgttccgctcgcctatgccagcggccagccgggtttcagcggctattttcccgatctg
ccggcggcggtcgaccccaagcgtatctgcacaatgggcctgcgcagtgtcgacccggcc
gagcgcagcgcgctcaaccaggcgggcgtaaccgtgcacgacatgcgcgccattgatgaa
catggtatcgcgccgctgctgcgcgccttcctggcgcgcgtgtctgatgaagacggactg
ctgcatgtcagtctcgacgtcgactttctcgacccgtcgattgcgccggctgtcggcacc
acggttcccggcggcgcgacgttccgcgaagcgcatctggtgatggagatgctgtccgac
agcggactcgtctccagtctcgacctggtcgagttgaatccatttctggacgagcgtggc
cggaccgcgacgctcatggtcgacctgacggcgagcctgatgggccgccgcatcatggat
cgcccgacccgcagccattccgggagcttttga

DBGET integrated database retrieval system