KEGG   Mesorhizobium japonicum MAFF 303099: mll7517Help
Entry
mll7517           CDS       T00043                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00260  Glycine, serine and threonine metabolism
mlo00750  Vitamin B6 metabolism
mlo01100  Metabolic pathways
mlo01110  Biosynthesis of secondary metabolites
mlo01120  Microbial metabolism in diverse environments
mlo01230  Biosynthesis of amino acids
Module
mlo_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    mll7517
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    mll7517
Enzymes [BR:mlo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     mll7517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: BAB53960
RhizoBase: mll7517
UniProt: Q985V2
Position
complement(6203238..6204635)
Genome map
AA seq 465 aa AA seqDB search
MQYVSTRGEAPALGFSDAVLAGLARDGGLYVPREWPQFSASEIRAMRGLAYPDLAIRVLS
PFLGGEIPAPVFERLVREAYATFRHEAVCPLVQTGTNTFVLELFHGPTLAFKDVAMQLLA
RLMDHVLAERDQHATIVGATSGDTGGAAIDAFAGRSRTDIFILFPHGRVSPVQQRQMTTS
KAENVHALAIEGNFDDCQGLLKDMFNDHAFRDRVALSGVNSINWARIMAQIVYYFSSALS
LGAPDRPVSFTVPTGNFGDIFAGYAAKKMGLPIERLVIATNDNDILARTFATGEYRTKGV
FATTSPSMDIQVSSNFERLLFEASNRDAATVRRYMDGLKQSGAFTIESREINGMRSEFDA
GRATMDEVAATIRSTLAASNYLLDPHTAAAMHVAAGKASGAVPMVVLGTAHPAKFPAAVE
AASGVSPALPAWLGGLMTFEEKYTVLPSDLKMVEDYVSRRARAAR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatgtgagtacgcgcggggaagcacccgcgcttggattttccgatgccgtgctg
gctgggctggcgcgcgatggtgggctttacgtgccgcgcgagtggccgcagttttcagct
tccgagatccgcgccatgcgtggccttgcctatcccgatctcgcgatccgcgtgctgtcg
ccgttccttggcggtgaaattccggcgccggttttcgaacgcctggtgcgcgaagcctat
gccacgttccgtcacgaggcggtctgcccgcttgtccagaccggcaccaatacctttgtc
ctcgaactcttccatgggccgacgctggcattcaaggatgtggcgatgcagctgctcgcc
cggctgatggaccatgtgcttgccgaacgcgatcagcatgccaccatcgtcggcgccacg
tcaggcgacaccggcggcgcggcgatcgacgcctttgccgggcgcagccgcaccgacatc
ttcatcctgttcccgcatggccgcgtttcgccggtgcagcagcgccagatgacgacgtcg
aaggccgagaacgtccatgcgctggcgatcgaaggcaatttcgacgactgccagggcctg
ctcaaggacatgttcaacgaccacgcctttcgcgaccgggtggcgctgtcgggggtcaat
tcgatcaactgggcgcgcatcatggcccagatcgtctattatttctcctcggcactgtcg
ctcggcgcgccggacaggccggtgtcgttcaccgtcccgaccggcaatttcggcgatatc
ttcgccggctacgccgccaagaagatgggcctgccgatcgagcggctggtcatcgccacc
aacgacaacgacatattggcgcgcaccttcgccaccggcgagtaccgcaccaagggtgtc
tttgcgaccacctcaccgtcgatggacatccaggtttcgtcgaatttcgaacgcctgctg
ttcgaggcctccaaccgtgacgcggcgaccgtgcggcgctacatggacggcctgaagcag
tccggcgccttcaccatagaatcccgcgaaatcaatgggatgcggtccgaattcgacgcc
ggccgcgccaccatggacgaggtcgccgccaccatccgttcgacgctcgcggccagcaat
tatcttctggatccgcacaccgcggcagccatgcatgtggcggccggcaaggcatcgggc
gccgtgccgatggtggtgctgggcacggcgcacccggcaaaatttccggccgccgtcgag
gccgccagcggggtctcgccggccctgcccgcatggctaggcggattgatgacatttgag
gaaaaatacacggtacttccatccgacctgaaaatggtggaagattatgtcagccgccgt
gcgcgagcggcgcgttag

DBGET integrated database retrieval system