KEGG   Mesorhizobium loti: mll8390Help
Entry
mll8390           CDS       T00043                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mlo  Mesorhizobium loti
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    mll8390
Enzymes [BR:mlo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     mll8390
Exosome [BR:mlo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   mll8390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(6893509..6894540)
Genome map
AA seq 343 aa AA seqDB search
MNKFTPTKPAGARSVDDVTGSRRLRRMRKADWSRRLVQENRLTVDDLIWPIFVVEGRNVR
EPIAAMPGVFRLSVDLAVKEAERAAKLGIPALATFPNVELALRDQTGSHILDPENIINRA
TRAIKDAVPGIGIITDAALDPFTSHGHDGILRDGIIVNDETVEQVAAAAVIQAAAGADII
APSDMMDGRIGAIRDALDANGFQDVAIMSYATKFASAFYGPYREAVGTAGLLKGDKKTYY
IDHANSDEAVREAEQDIAEGADMLMVKPGLPYLDIIRRLKDEFQMPTFAYQVSGEYSMIK
AAGANGWIDGEKAMLESLLAFKRAGCDGILTYFAPEVAEMLKG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaattcaccccgacaaagccggccggcgcgcgcagcgtcgacgacgtcaccggc
agccgccgcctgcgccgcatgcgcaaggccgactggtcgcgccgcctggtgcaggagaac
cggcttacggtcgacgacctgatctggccgattttcgttgtcgagggcaggaacgtacgc
gagccgatcgccgccatgcccggcgtcttccgcctgtcggtcgatcttgccgtcaaggag
gctgaacgcgcggccaagctcggcattccggcgctcgccaccttccccaatgtcgaactg
gccttacgcgaccagaccggctcgcacatcctcgacccggaaaacatcatcaaccgcgcc
acgcgcgcgatcaaggacgcggtgcccgggatcggcatcatcaccgacgccgcgctcgac
ccgttcaccagccacggccatgacggcatcctgcgcgacggcatcatcgtcaacgacgaa
acggtcgaacaggtcgcggcggcggccgtcatccaggcagcggccggcgccgacatcatc
gcgccttccgacatgatggacggccgcatcggcgccatccgcgacgcgctcgacgccaat
ggttttcaggacgtggcgatcatgtcctatgcgaccaagttcgcctcggccttctacggc
ccctatcgcgaggccgtcggcaccgccggcctgctcaagggcgacaagaagacctactac
atcgaccatgccaattcggacgaggcggtgcgcgaggccgagcaggacatcgccgagggc
gccgacatgctgatggtcaagcccggcctgccctatctcgacatcatccgccggctgaag
gacgaattccagatgccgaccttcgcctaccaggtgtcgggcgaatattcgatgatcaag
gcggcgggcgccaatggctggatcgacggcgagaaggcgatgctggaatcgctgctcgcc
ttcaagcgcgccggctgcgacggcatcttgacctatttcgcgcccgaagtggccgaaatg
ctgaaggggtag

DBGET integrated database retrieval system