KEGG   Mesorhizobium loti: mll8468Help
Entry
mll8468           CDS       T00043                                 

Definition
cytochrome P-450 hydroxylase
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
mlo  Mesorhizobium loti
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    mll8468
  Amino acid metabolism
   00380 Tryptophan metabolism
    mll8468
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    mll8468
Enzymes [BR:mlo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     mll8468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(6955248..6956498)
Genome map
AA seq 416 aa AA seqDB search
MTNSTLPYLAFDPATRRLRLDPHEPAFFLNPYEAYGFLHDVSNAFFWEEFGFWCFGGFDD
VNRLLRDRRFGRQNPAGIPDSRGVGQDRSHLRAFDGIEANSMLELEPPVHTRLRTLVNRA
FVSRQVERLRPRVEALANELIDRFDPTGPVDLLPAFASPLPITIIAEMLGVPVEMGPQLL
DWSHQMVAMYIHGRTRETEETANRAASEFADFLRGYVAERRRNPGDDLLSLLISAQEDGE
RLSEDEMVSSAILLLNAGHEATVHQTGNAVRSILAQGGDPSRFFTSAEATAATVEECLRF
DAPLHMFMRYAYQEIEIAPGIVVRPGQTIGLLLGMANHDPRAFAEPQAFRPDRADQKNVS
FGAGIHFCIGAPLARLELQVSLKTLFERHPRLHLAEQSRFRDTYHFHGLETLAVGF
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaccaattcgacgctcccatacctggcctttgatccagccacccgacggctgcggctc
gacccgcacgagccggctttcttcctgaacccgtacgaggcctatggcttcctgcacgac
gtctccaatgccttcttctgggaggaattcggcttctggtgctttggcggcttcgatgat
gtcaaccggctgctgcgcgaccgccgcttcggccgccagaacccggccggcattcccgac
agccgcggtgtcggccaggaccgcagccatctcagagcgttcgacggcattgaagccaac
tccatgctcgaactggaaccgccggtgcacacgcggctgagaacgctggtcaaccgcgcc
ttcgtctcgcgccaggtcgagcggctgcggccacgggtcgaggcgctcgccaacgaactg
atcgaccgctttgatccgaccggaccggtcgacctgcttcccgccttcgcctctcccttg
ccgatcaccatcatcgccgaaatgctcggcgtgccggtcgagatggggccgcaactgctc
gactggtcccaccaaatggtcgccatgtacatccacggccgcacccgcgagaccgaggaa
acagccaaccgcgccgcgagcgaatttgccgatttcctgcgcggttacgtcgccgagcgg
cgcagaaatcccggcgacgaccttttgtcgctgctgatctcggcgcaggaggacggtgag
aggctgtccgaggacgaaatggtgtcctcggcgatcctgctgctcaatgccggccacgaa
gcgaccgtccatcagaccggcaatgcggtgcgctcgatcctggcgcaaggcggcgacccc
agccgtttcttcacctcggcggaagcgaccgccgcaacggtcgaggaatgcctgcgcttc
gacgcaccgctgcacatgttcatgcgctatgcctaccaggagatcgagattgcgcccggc
atcgtcgtccggccgggccagaccatcgggctcttgcttggcatggccaatcatgatccg
cgcgccttcgccgaaccgcaggccttccggccggaccgtgcggaccagaagaacgtgtcc
ttcggcgccggcatccatttctgcatcggcgcgccgctggcccggctcgaattgcaggtg
tcgttgaaaaccttgttcgagcggcacccgcggctgcatcttgccgaacagtcacgcttc
cgcgacacttaccacttccatgggctggaaacgctcgccgtcggcttctga

DBGET integrated database retrieval system