KEGG   Mesorhizobium loti: mll9542Help
Entry
mll9542           CDS       T00043                                 

Definition
(RefSeq) threonine synthase-like protein
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mlo  Mesorhizobium loti
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    mll9542
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    mll9542
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    mll9542
Enzymes [BR:mlo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     mll9542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pMLb:complement(29270..30532)
Genome map
AA seq 420 aa AA seqDB search
MHANRVLEFACIRCGASAPADVTIDSRGCARCQDTAPANLRPVYAVPHLDPLDGATSSRS
LWRFAHMLPCTEAEAVSLGEGLTPLLAAPRIGAFLGVPNLAIKDEGRNPTWSHKDRFSTI
AVSVARARGAKIVATASSGNAGASLAAYAARAGLKCVVTTFAGSAGAMLAQIRKYGATVL
PLVSKMDRWSLLEQAAARYDWFIASPYHGPVVGSHPLGIEGYKTIAYEIVEQSDGTAPDW
CVLPVCYGDALSGVWAGFCELFAQGSITRLPRLVAAEVHGSLADALASGADAVSERQMLF
DSLAVSIGTPRSTFQALKALRESGGHAVPVSNHGLIAMQERLARDEGIFAELASVTPLIA
ISKLRDQGIIATPDRVVAVVTASGLKDLDRSAGSNEHDQIFRTTDDAWRWLDKNGLDLVS
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcaaatcgtgtcctggagttcgcttgcatccgatgcggcgcttccgctcctgcg
gacgtcacaatcgactccaggggatgcgcgcgctgccaagacaccgcgccggcaaatctt
cgcccggtttatgcggtcccgcacctcgatcctttggacggcgccaccagctcgcgctcg
ctgtggcgttttgcgcatatgctgccttgcacagaagcggaggccgtaagccttggtgag
ggtctgacacctttgcttgccgcaccgcgcatcggcgcgtttctcggcgtgcctaacctc
gcaatcaaggacgaaggccgaaacccgacctggtcgcacaaggaccgcttctcgacgatc
gcggtcagcgtggcgcgcgcacgtggcgcgaagatcgtcgcgaccgcctcctcgggaaac
gccggcgcttcgctggcggcgtacgccgcccgagccgggttgaaatgcgtcgtcaccact
ttcgcgggatcagccggcgcgatgctggcgcagatccgcaagtatggcgcgacggtcctg
cccttggtcagcaaaatggaccgatggtcactgctcgaacaggcggcggcccgctacgac
tggttcatcgcatcgccctatcacggtcctgtcgtcggcagccatccactcggcatcgag
ggctacaagacgatcgcctatgagatcgtcgagcaatcagatggcacggcgccagactgg
tgcgtcctgccggtctgctatggcgatgcgttgtccggcgtgtgggccggcttttgcgag
ctgttcgcgcaaggctcgatcacgcgcctgcctcgtctcgtcgcggcggaggtgcatggg
tcgctggcggacgctctggccagcggcgccgatgcggtgagtgaacgccagatgcttttc
gacagccttgccgtatcgatcggcacgccgcgcagcacctttcaggcgctgaaggcgctg
cgcgaatccggcgggcacgccgtgcccgtcagcaatcacggcctgatcgcgatgcaggag
cgccttgcgcgggacgaagggatctttgccgaactggcgtcggtcacgccgctgatcgcg
atatcgaaattaagggaccaaggtatcatcgcaaccccagaccgtgtcgtggccgtcgtg
acagccagcggcctcaaggacctcgatcggtccgccggatcgaacgaacacgatcagatc
ttccggacgacggacgacgcctggcgctggctcgacaagaacgggctggatctcgtttca
tag

DBGET integrated database retrieval system