KEGG   Mesorhizobium loti: mll9542Help
Entry
mll9542           CDS       T00043                                 

Definition
threonine synthase-like protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mlo  Mesorhizobium loti
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mlo01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mlo00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:mlo00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
pMLb:complement(29270..30532)
Genome map
AA seq 420 aa AA seqDB search
MHANRVLEFACIRCGASAPADVTIDSRGCARCQDTAPANLRPVYAVPHLDPLDGATSSRS
LWRFAHMLPCTEAEAVSLGEGLTPLLAAPRIGAFLGVPNLAIKDEGRNPTWSHKDRFSTI
AVSVARARGAKIVATASSGNAGASLAAYAARAGLKCVVTTFAGSAGAMLAQIRKYGATVL
PLVSKMDRWSLLEQAAARYDWFIASPYHGPVVGSHPLGIEGYKTIAYEIVEQSDGTAPDW
CVLPVCYGDALSGVWAGFCELFAQGSITRLPRLVAAEVHGSLADALASGADAVSERQMLF
DSLAVSIGTPRSTFQALKALRESGGHAVPVSNHGLIAMQERLARDEGIFAELASVTPLIA
ISKLRDQGIIATPDRVVAVVTASGLKDLDRSAGSNEHDQIFRTTDDAWRWLDKNGLDLVS
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcaaatcgtgtcctggagttcgcttgcatccgatgcggcgcttccgctcctgcg
gacgtcacaatcgactccaggggatgcgcgcgctgccaagacaccgcgccggcaaatctt
cgcccggtttatgcggtcccgcacctcgatcctttggacggcgccaccagctcgcgctcg
ctgtggcgttttgcgcatatgctgccttgcacagaagcggaggccgtaagccttggtgag
ggtctgacacctttgcttgccgcaccgcgcatcggcgcgtttctcggcgtgcctaacctc
gcaatcaaggacgaaggccgaaacccgacctggtcgcacaaggaccgcttctcgacgatc
gcggtcagcgtggcgcgcgcacgtggcgcgaagatcgtcgcgaccgcctcctcgggaaac
gccggcgcttcgctggcggcgtacgccgcccgagccgggttgaaatgcgtcgtcaccact
ttcgcgggatcagccggcgcgatgctggcgcagatccgcaagtatggcgcgacggtcctg
cccttggtcagcaaaatggaccgatggtcactgctcgaacaggcggcggcccgctacgac
tggttcatcgcatcgccctatcacggtcctgtcgtcggcagccatccactcggcatcgag
ggctacaagacgatcgcctatgagatcgtcgagcaatcagatggcacggcgccagactgg
tgcgtcctgccggtctgctatggcgatgcgttgtccggcgtgtgggccggcttttgcgag
ctgttcgcgcaaggctcgatcacgcgcctgcctcgtctcgtcgcggcggaggtgcatggg
tcgctggcggacgctctggccagcggcgccgatgcggtgagtgaacgccagatgcttttc
gacagccttgccgtatcgatcggcacgccgcgcagcacctttcaggcgctgaaggcgctg
cgcgaatccggcgggcacgccgtgcccgtcagcaatcacggcctgatcgcgatgcaggag
cgccttgcgcgggacgaagggatctttgccgaactggcgtcggtcacgccgctgatcgcg
atatcgaaattaagggaccaaggtatcatcgcaaccccagaccgtgtcgtggccgtcgtg
acagccagcggcctcaaggacctcgatcggtccgccggatcgaacgaacacgatcagatc
ttccggacgacggacgacgcctggcgctggctcgacaagaacgggctggatctcgtttca
tag

DBGET integrated database retrieval system