KEGG   Mesorhizobium japonicum MAFF 303099: mlr0211Help
Entry
mlr0211           CDS       T00043                                 

Definition
(GenBank) glutaminase A
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00220  Arginine biosynthesis
mlo00250  Alanine, aspartate and glutamate metabolism
mlo00471  D-Glutamine and D-glutamate metabolism
mlo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    mlr0211
   00220 Arginine biosynthesis
    mlr0211
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    mlr0211
Enzymes [BR:mlo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     mlr0211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Peptidase_S11 Beta-lactamase PT-TG
Motif
Other DBs
NCBI-ProteinID: BAB47844
RhizoBase: mlr0211
UniProt: Q98NB7
Position
143624..144571
Genome map
AA seq 315 aa AA seqDB search
MPELERAPKLDQALAEVAAEMAERTDRGDVATYIPQLGKVDPRKFGIAAVTNDGRVLVAG
DADQAFSIQSISKVFTLTLALGNVGDALWQRVGREPSGNPFNSIVQLEHENGIPRNPFIN
AGAIVISDILLAGHQPREAIGEILRFIQFLADDDTIIIDREVAASERATGYRNFALANYM
KSFGNLHHAPELALGVYFHHCAIAMSCRQLAMAGRFLANGGKNPATGHSVVSAERARRIG
AMMLTCGHYDGSGDFAFRVGIPGKSGVGGGILGIVPGVASLAVWSPGLNANGNSKLGSIA
LEKLARMMNWSIFAP
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgccggaactcgaacgggcccccaaacttgatcaagcattggccgaagtcgccgccgaa
atggccgaacgcaccgatcgcggcgatgtcgccacctacattcctcagctgggcaaggtc
gatccaaggaaattcggcattgccgccgtcaccaatgacggccgcgtcctggtggccggc
gatgccgaccaggctttttcgatccagagcatctccaaggtgttcaccttgacgctggcg
ctcggcaatgtcggcgacgcgctgtggcagagggtcgggcgcgagccgtcgggcaatccg
ttcaattcgatcgtccagctcgaacacgagaacggcattccgcgcaatccgttcatcaat
gccggcgccatcgtcatttccgacatcctgcttgccggtcatcagccgcgcgaggcgatc
ggcgagatcctgcgcttcatccagttcctggccgacgacgacaccatcatcatcgaccgc
gaggtcgctgcctccgagcgcgccaccggctatcgcaacttcgcgctcgccaactacatg
aaatccttcggcaatcttcatcatgcaccggaactggcgctgggcgtctatttccaccat
tgcgccatcgccatgagctgccggcaactggcgatggccggccgcttcctcgccaatggc
ggcaagaacccggccaccggtcattccgtggtatcggcggagcgagcgcggcgcatcggc
gccatgatgctgacctgcggccactatgatggctccggcgatttcgccttccgcgtcggc
attccgggaaaaagcggcgtcggtggcggcatattgggcattgtgccgggtgtggcgtcg
cttgcggtgtggtcgcccgggctcaacgccaacggcaattccaagctgggttcgatcgcg
ctggagaagctggccaggatgatgaactggtcgatcttcgcgccataa

DBGET integrated database retrieval system