KEGG   Mesorhizobium japonicum MAFF 303099: mlr0615Help
Entry
mlr0615           CDS       T00043                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mlo01100  Metabolic pathways
mlo01110  Biosynthesis of secondary metabolites
mlo01130  Biosynthesis of antibiotics
mlo01230  Biosynthesis of amino acids
Module
mlo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    mlr0615
Enzymes [BR:mlo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     mlr0615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: BAB48170
RhizoBase: mlr0615
UniProt: Q98ME3
Position
480482..481294
Genome map
AA seq 270 aa AA seqDB search
MSDILRKIEAYKRDEIAAAKAHVPLAEIKARAKDADAPRGFLAALEAKRRSGRFALIAEI
KKASPSKGLIRADFDPPALAQAYEKGGAACLSVLTDAPSFQGAPEFLTKARAAVALPALR
KDFLFDPYQVYEARAWGADAILIIMASVDDALASALEATAFELGMDALIEVHDEAETQRA
LKLSSRLIGINNRNLRTFETSLETSERLATMVPADRLLVSESGIFTHDDCLRLQKKDIGT
FLVGESLMRQEDVTAATRILLTGKALAEVV
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgacattctgcgcaagatcgaggcctacaagcgcgacgagatcgccgccgccaag
gcacacgtgccgctggccgagatcaaggcgcgggcgaaggacgccgacgcaccacgcggc
tttcttgcagccctggaggcaaagcgcagatcaggccgcttcgccctgatcgccgaaatc
aagaaggcgagcccctccaaaggcctgatccgtgccgatttcgatccgccggcactggcg
caggcctatgagaaaggcggcgccgcctgtctttcggtattgaccgatgcgccgtccttc
cagggcgcgccggaattcctcaccaaggcaagggcagccgtcgccctgcccgccctgcgc
aaggatttcctgttcgatccctatcaggtctatgaggcgcgcgcctggggcgcggatgct
atcctgatcatcatggccagcgtcgacgatgcgctggcgagcgcattggaagcgaccgca
ttcgaactcggcatggatgcgctgatcgaggtacatgacgaagccgagacgcaacgagcg
ctaaagctgtcgtcgcggctgatcggcataaacaaccgcaatctgagaacgttcgagacc
agcctcgaaacctccgagcggctggcaacgatggtgccggccgaccgcttgctggtcagt
gagagcggcatcttcacacatgacgattgcctcaggctgcagaagaaggacatcggcacc
ttccttgtcggcgagagcctgatgcggcaggaggatgtcaccgcggcgacccgcattctg
ctgacgggcaaggcgctggccgaggtcgtctga

DBGET integrated database retrieval system