KEGG   Mesorhizobium loti: mlr0825Help
Entry
mlr0825           CDS       T00043                                 

Definition
hypothetical protein
Orthology
K13590  
diguanylate cyclase
Organism
mlo  Mesorhizobium loti
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
653485..654741
Genome map
AA seq 418 aa AA seqDB search
MEVVRIKETLALPHLWSHQAKMAGGDASLRKTFWAIGSRSPCRRSTEPANSALGSEGKSG
SDMQPAAATTERSTDIAATVVATMRQLGVLGLPRNYEIFYEALSGTNRELSLAVVSLSSR
PTQDELDKIGRAFFAQNHGPGIVEHARDVIARELEEVAALLRSERSHIEKYGRILDETSN
GLSGRSLLSQDLLQKIANAMAVATNSTIDHGKQIASTLSDKTAELESVKSKLEEYKRLAD
TDPLTQIRNRRAFDKEITRIYNSNKGILFNALILADIDRFKDINDRYGHPVGDKIIQIIA
EIFQTSIRGDMFVARTGGEEFALIIEGASEDATYEIAERIRALIEQTPFTSSQTGMNYGT
VTVSMGICMASEAEGPEDLYTKADRALYRSKVSGRNRVTKHSTMAGRAGKSWLLYKKD
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtggaagtcgtgcgcattaaggaaactttagcgctaccgcatctatggtcacaccaagcg
aagatggcgggtggggacgcgtctcttcgcaagacgttctgggctatcgggtcgcgctcc
ccatgtcggcgatcaacggaacccgcaaattccgcgctgggatccgaggggaagagtgga
tcagacatgcagccggcagccgccacgaccgaacgaagcaccgacatcgcagccacggtt
gttgccaccatgcgccagcttggcgtcctcggcctgccgcgcaactacgaaatcttctac
gaggcattgagcggcaccaaccgcgagctcagcctcgccgtcgtgtcactgagcagccgg
ccgacgcaggatgagctggataagatcggacgcgccttctttgcccagaaccacggcccc
ggcatcgtcgagcatgcgcgggacgtcatcgcccgggaactcgaggaggtcgcggcgctg
ctgcgcagcgaacgcagccacatcgaaaaatacggcaggatcctcgacgagacatcgaac
ggcctgagtggccgcagcctgctctcccaggatctcctgcaaaaaatcgccaacgccatg
gccgttgccaccaattcgacgatcgatcacggcaagcagatcgcctcgacgctcagcgac
aagacggccgaactcgaaagcgtcaagtcgaagctggaggaatacaagcggctggccgat
acggatccgctgacccagatccggaaccgccgcgccttcgacaaggaaatcacccggatc
tacaacagcaacaagggtatcctgttcaatgctttgatccttgccgacatcgatcggttc
aaggacatcaacgaccgctacggccatcctgtcggcgacaagatcatccagatcatcgcc
gagattttccagaccagcattcgcggcgacatgttcgtcgcccgcaccggcggcgaggag
ttcgcgctgatcatcgagggcgccagcgaagacgccacctacgagatcgccgagcgcatt
cgcgccctgatcgagcagacgccgttcaccagcagccagaccggcatgaattacggaacc
gtcaccgtctcgatgggcatctgcatggcatccgaggccgaaggcccggaagacctctac
accaaggccgaccgggcgctctaccgttcgaaagtgagcggccgcaaccgcgtcaccaag
cattcgacgatggccggccgcgccggcaagagctggctgctctacaagaaggactga

DBGET integrated database retrieval system