KEGG   Mesorhizobium loti: mlr0922Help
Entry
mlr0922           CDS       T00043                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mlo  Mesorhizobium loti
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mlo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
744830..745423
Genome map
AA seq 197 aa AA seqDB search
MEKPVTDRPSEAEVEAAVRTLLRWTGDNPDREGLIDTPKRVAKAFREMFGGYDMCPAEEL
GRTFEEVAGYDDLVIVKDIHFHSHCEHHMVPIIGKAHVGYLPDGKVVGLSKIARVVDIFA
HRLQTQEALTAQIAGVIQDVLNPRGVAVMIEAEHMCMAMRGIRKQGSTTLTSTFTGVFKD
TPEEQVRFVTMVRGGGA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagccggtcaccgaccgaccgagcgaagccgaggtcgaggcggccgtgcgcaca
ttgctgcgctggaccggcgacaatccggaccgcgaggggctgatcgatacgcccaagcgc
gtggccaaggccttccgcgaaatgttcggcggctacgacatgtgcccggccgaggagctc
ggccgcaccttcgaggaggtcgccggctacgacgatctcgtcatagtgaaggatattcac
ttccattcgcattgcgagcaccacatggtgccgatcatcggcaaggcgcatgtcggctat
ctgccggatggcaaggtcgtcggcctgtcgaagatcgcgcgcgtcgtcgatatcttcgcc
catcgcctgcagacgcaggaagcactgaccgcgcaaatcgccggcgtcatccaggatgtg
ctcaatccgcgcggcgtcgccgtcatgattgaggccgagcacatgtgcatggccatgcgc
ggcatccgcaagcagggctccaccaccctcacctccaccttcaccggcgttttcaaggat
acgcccgaggagcaggttcgtttcgtcaccatggttcgcggcggcggggcataa

DBGET integrated database retrieval system