KEGG   Mesorhizobium loti: mlr1041Help
Entry
mlr1041           CDS       T00043                                 

Definition
cytochrome C oxidase subunit I
Orthology
K02274  
cytochrome c oxidase subunit I [EC:1.9.3.1]
Organism
mlo  Mesorhizobium loti
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome c oxidase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    mlr1041
Enzymes [BR:mlo01000]
 1. Oxidoreductases
  1.9  Acting on a heme group of donors
   1.9.3  With oxygen as acceptor
    1.9.3.1  cytochrome-c oxidase
     mlr1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
875320..877089
Genome map
AA seq 589 aa AA seqDB search
MVDITPADGIPPAEVAEVELYHPHSWWTKYVFSQDAKVIAVQYSATATAIGLVALVLSWL
MRLQLGFPGTFDFITPEAYYQFITMHGMIMVIYLLTALFLGGFGNYLIPLMVGARDMVFP
YVNMLSYWIYLLAVLVLVSSFFAPGGPTGAGWTLYPPQAIMSGTPGGQDWGIILMLSSLI
LFIIGFTMGGLNYVVTVLQGRTRGMTMMRLPLTVWGIFTATVMALLAFPALFVASVMMLL
DRVLGTSFFMPAISEMGEQLQHNGGSPILFQHLFWFFGHPEVYIVALPAFGIVSDLISTH
ARKNIFGYRMMVWAIVGIGALSFVVWAHHMYVSGMHPYFGFFFATTTLIIAIPTAIKVYN
WVLTLWRGDIHLTIPMLFALAFIVTFVNGGLTGLFLGNVVVDVPLSDTMFVVAHFHMVMG
VAPILVVFGAIYHWYPKVTGRMLDETLGRFHFWVTFLGAYLIFFPMHYLGLMGVPRRYAE
LTDMTIMTESAHHLNSFISVMAFIVGFAQMVFLFNLIWSIRHGREAGGNPWRATTLEWQT
PQTPPAHGNFGKDLPIVYRWAYDYSVPGAKEDFIPQNMPGSFGPSREPA
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacatcacccctgcagatggcattccgccggccgaagtcgcggaagtcgaactc
taccatccgcacagttggtggaccaaatacgtcttttcgcaggacgccaaggtcatcgcc
gtccagtattcggcgacggcaacggcaatcggcctggtcgccctggtgctgtcctggctg
atgcggctgcagcttggctttcccggcacgttcgacttcatcaccccggaggcctactac
cagttcatcaccatgcacggcatgatcatggtgatctacctgctcaccgccctcttcctc
ggcggctttggcaactatctgatccccttgatggtcggcgcgcgcgacatggtcttcccc
tatgtcaacatgctgagctactggatctacctgcttgccgtgctggttctggtgtcgagc
ttcttcgcgcccggcggaccgacgggggccggctggacgctctacccgccgcaggccatc
atgagcgggacgccaggcggccaggactggggcatcatcctgatgctctcctcgctgatc
ctgttcatcatcggcttcacgatgggtggcctcaactatgtcgtgaccgtgctgcagggc
cgcacgcgcggcatgacgatgatgcgcctgccgctgaccgtctggggcatcttcaccgca
accgtcatggcgctgctcgcctttccggcgctgttcgtcgccagcgtgatgatgctgctc
gaccgcgtcctgggcaccagcttcttcatgccggcgatctctgaaatgggtgagcagctg
caacacaatggcggcagcccgatcctgttccagcacctgttctggttcttcggccatccc
gaggtctacatcgtggcgctgccggccttcggcatcgtatccgacctgatcagcacccat
gcgcgcaagaacatcttcggctaccggatgatggtctgggccatcgtcggcattggcgcg
ctgagcttcgtggtctgggcgcaccacatgtatgtcagcggcatgcacccctatttcggc
ttcttcttcgccaccacgacgctgatcatcgccattccgacggccatcaaggtctacaat
tgggtgctgaccctatggcgcggcgacatccatctcaccataccaatgttgttcgccctg
gccttcatagtgaccttcgtcaacggcgggctgaccggcctgttccttggcaatgtcgtc
gtcgatgttccgctatccgacacgatgttcgtcgtcgcccatttccatatggtcatgggt
gtcgccccgatcctcgtggtttttggcgcgatctaccattggtacccgaaggtcaccggc
cggatgctcgacgaaaccctgggccggttccatttctgggtcaccttcctcggcgcctac
ctgattttcttccccatgcactacctcggcctgatgggcgtgccgcggcgctatgctgaa
ctgaccgacatgacgatcatgacggagtcggcccatcacctgaactcgttcatcagcgtc
atggccttcatcgtcggcttcgcccagatggtgttcctgttcaacctgatctggagcatc
cgccatggccgcgaggccggcggcaatccgtggcgggccacgaccctcgaatggcagacg
ccgcaaacaccgccggcccacggcaatttcggcaaggacctgccgatcgtctatcgctgg
gcttatgattacagcgtaccgggcgccaaggaagacttcatcccgcagaacatgccgggc
tccttcggcccctcaagggagccggcatga

DBGET integrated database retrieval system