KEGG   Mesorhizobium loti: mlr1136Help
Entry
mlr1136           CDS       T00043                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
mlo  Mesorhizobium loti
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    mlr1136
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mlr1136
  Lipid metabolism
   00071 Fatty acid degradation
    mlr1136
  Amino acid metabolism
   00350 Tyrosine metabolism
    mlr1136
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    mlr1136
   00626 Naphthalene degradation
    mlr1136
Enzymes [BR:mlo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     mlr1136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
952157..953197
Genome map
AA seq 346 aa AA seqDB search
MKAVVFEKFGEAPTIQTVPDPKPAADGVVIKVEATGLCRSDWHGWMGHDDGITLPHVPGH
ELAGVVVAAGKQVSRWKAGDRVTVPFAVGCGRCFECSSGNHQVCEHQTQPGFTGWGSFAE
YVGIEHADTNLVRLPDEMEYATAASLGCRFVTSFRAIVDQGRVKPGEWVAVHGCGGVGLS
AIMIASSMGANVIAIDLTDEKLEFARKIGAVATINASTTPNVVKAVKQIANGGAHMSMDA
LGHPTTSFNSIANLRRRGRHVQVGLMLGEHARPQVPMDKIIAFELEILGSHGMQAYRYQA
MMDMIRNGKLKPELLVGKKISLDEAPAALMAMGGFEGIGIGVVTKF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtcgtcttcgagaaattcggcgaagcgccgacgatccagaccgtccccgat
ccgaagccggctgccgatggcgtcgtcatcaaggtcgaggcgacagggctgtgccgcagc
gactggcatggctggatgggccatgatgacggcatcaccttgccgcacgttcccggacat
gaacttgcaggcgtcgtcgtcgccgccggcaagcaggtcagccgctggaaggccggcgac
cgcgtgacggtgccgtttgccgtcggctgcggccgctgcttcgaatgcagctctggcaac
catcaggtctgcgagcaccagacgcagcccggcttcaccggctggggctcgttcgccgaa
tatgtcggcatcgagcatgccgacaccaacctcgtgcgcctgcccgacgagatggaatac
gccaccgccgccagcctcggctgccgtttcgtcacctcgtttcgcgccattgtcgaccag
gggcgggtcaagcccggcgaatgggtggcggtgcatggctgcggcggcgtcggcctgtcg
gcaatcatgatcgccagttcgatgggcgccaacgtgatcgccatcgacctcaccgacgag
aagctggagttcgccagaaaaatcggcgccgtggcgacgatcaatgcgtcgacgacgccg
aatgtggtcaaggcggtcaagcagatcgccaatggcggcgcgcatatgtcgatggacgcg
ctcggccaccccaccacctcgttcaactcgatcgccaatctgcgccggcgcggccgccat
gtgcaggtcggcctgatgctgggcgagcacgcccgcccgcaagtgccgatggacaagatc
atcgccttcgagctcgagatcctcggcagccacggcatgcaggcctatcgctaccaggcg
atgatggacatgatccgcaacggcaagctcaagcccgaactgctggtcggcaagaagatc
agcctcgacgaggcgcccgcggccttgatggcaatgggtggcttcgagggcattggcatt
ggggttgtgacgaaattctga

DBGET integrated database retrieval system