KEGG   Mesorhizobium japonicum MAFF 303099: mlr1185Help
Entry
mlr1185           CDS       T00043                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00300  Lysine biosynthesis
mlo01100  Metabolic pathways
mlo01120  Microbial metabolism in diverse environments
mlo01230  Biosynthesis of amino acids
Module
mlo_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    mlr1185
Enzymes [BR:mlo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     mlr1185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: BAB48620
RhizoBase: mlr1185
UniProt: Q98L43
Position
996669..997946
Genome map
AA seq 425 aa AA seqDB search
MNERLLQAIDDRRDDVVALTADLIRFPTINPPGEAYRPCAEFVGARLRKRGFETEFIRAE
GTPGDTDRYPRVNVVARFDGRSPGACVHFNSHIDVVEAGDGWTVDPFAGIVRDGRVYGRG
ACDMKGGLAASIIAAEAFMEVYPDFPGTIEISGTVDEESGGFGGVAHLAGLGYFSKPRVD
HVIIPEPLNKDRICLGHRGVWWAEIETKGEIAHGSMPFLGDNAVRHMGAVLQAFEDELFP
ALDRKMTRMPVVPEGARRSTMNINSIHGGQTEDFRPGLPSPNVPDSCRLTIDRRFLLEED
LATVKGEVTGILERLKRERKKFDYEIRDLMEVLPLMTERDAPVVKAVAQGIHAIFDREPD
YVISPGTYDQKHIARIGHIYDCIAYGPGILDLAHRPDEWVGIEDMVESAKVMAIGLNVLL
RGTTG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagcgactccttcaagcaatcgatgacaggcgcgacgatgttgtcgcgctgacc
gctgacctgatccgtttcccgaccatcaatccgcctggcgaagcctaccggccatgtgcg
gaatttgtcggcgcgcggctgaggaaacgtggttttgaaaccgaattcatccgtgccgaa
ggcacgcccggcgacaccgaccgctacccgcgcgtcaatgtcgtggcccgtttcgacggc
cgatcgcccggcgcctgcgtccacttcaactcgcatatcgacgtggtcgaggccggcgac
ggctggaccgtcgatccctttgccggcatcgtcagggacggcagggtttatggacgcggc
gcctgcgacatgaagggcggcctggccgcgtcgatcatcgccgccgaggcgttcatggag
gtctatcccgactttcccggcaccatcgagatatccggcaccgtcgacgaggagtccggc
ggctttggcggtgtcgcgcatctggccgggctcggctatttctccaaacccagggtcgac
cacgtcatcatccccgaaccgctgaacaaggaccgcatctgccttggccatcgcggcgtc
tggtgggccgagatcgaaaccaagggcgaaatcgcgcacggctcgatgccgtttctcggc
gacaatgcggtgcgccatatgggcgccgtgctgcaagctttcgaggacgaactgttcccg
gcactcgaccgcaagatgacgcgcatgccggtggtgcccgaaggcgccaggcgctcgacc
atgaacatcaattccatccatggcggccagaccgaagatttccgacccggcctgccctcg
cccaacgtgcccgattcctgccggctgaccatcgaccgccgcttcctgctcgaggaagac
ctcgccacggtcaaaggcgaagtgaccggcattctcgagcggctgaagcgcgagcgcaaa
aagttcgattacgagatccgcgacctgatggaagtgctgccgctgatgaccgagcgcgac
gcgccggtggtcaaggccgtggcgcaaggcattcatgcgatcttcgaccgcgagcccgac
tacgtcatttcgcccggcacctacgaccagaagcacattgcccgcatcggccacatctac
gactgcatcgcctatgggcccggcattctcgacctcgcccaccggccagacgaatgggtt
ggcatagaggacatggtggaatcggccaaggtgatggcgatcggcctcaacgtgctgctg
cgcggcacgaccggatga

DBGET integrated database retrieval system