KEGG   Mesorhizobium loti: mlr1185Help
Entry
mlr1185           CDS       T00043                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mlo  Mesorhizobium loti
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mlo01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mlo00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
996669..997946
Genome map
AA seq 425 aa AA seqDB search
MNERLLQAIDDRRDDVVALTADLIRFPTINPPGEAYRPCAEFVGARLRKRGFETEFIRAE
GTPGDTDRYPRVNVVARFDGRSPGACVHFNSHIDVVEAGDGWTVDPFAGIVRDGRVYGRG
ACDMKGGLAASIIAAEAFMEVYPDFPGTIEISGTVDEESGGFGGVAHLAGLGYFSKPRVD
HVIIPEPLNKDRICLGHRGVWWAEIETKGEIAHGSMPFLGDNAVRHMGAVLQAFEDELFP
ALDRKMTRMPVVPEGARRSTMNINSIHGGQTEDFRPGLPSPNVPDSCRLTIDRRFLLEED
LATVKGEVTGILERLKRERKKFDYEIRDLMEVLPLMTERDAPVVKAVAQGIHAIFDREPD
YVISPGTYDQKHIARIGHIYDCIAYGPGILDLAHRPDEWVGIEDMVESAKVMAIGLNVLL
RGTTG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagcgactccttcaagcaatcgatgacaggcgcgacgatgttgtcgcgctgacc
gctgacctgatccgtttcccgaccatcaatccgcctggcgaagcctaccggccatgtgcg
gaatttgtcggcgcgcggctgaggaaacgtggttttgaaaccgaattcatccgtgccgaa
ggcacgcccggcgacaccgaccgctacccgcgcgtcaatgtcgtggcccgtttcgacggc
cgatcgcccggcgcctgcgtccacttcaactcgcatatcgacgtggtcgaggccggcgac
ggctggaccgtcgatccctttgccggcatcgtcagggacggcagggtttatggacgcggc
gcctgcgacatgaagggcggcctggccgcgtcgatcatcgccgccgaggcgttcatggag
gtctatcccgactttcccggcaccatcgagatatccggcaccgtcgacgaggagtccggc
ggctttggcggtgtcgcgcatctggccgggctcggctatttctccaaacccagggtcgac
cacgtcatcatccccgaaccgctgaacaaggaccgcatctgccttggccatcgcggcgtc
tggtgggccgagatcgaaaccaagggcgaaatcgcgcacggctcgatgccgtttctcggc
gacaatgcggtgcgccatatgggcgccgtgctgcaagctttcgaggacgaactgttcccg
gcactcgaccgcaagatgacgcgcatgccggtggtgcccgaaggcgccaggcgctcgacc
atgaacatcaattccatccatggcggccagaccgaagatttccgacccggcctgccctcg
cccaacgtgcccgattcctgccggctgaccatcgaccgccgcttcctgctcgaggaagac
ctcgccacggtcaaaggcgaagtgaccggcattctcgagcggctgaagcgcgagcgcaaa
aagttcgattacgagatccgcgacctgatggaagtgctgccgctgatgaccgagcgcgac
gcgccggtggtcaaggccgtggcgcaaggcattcatgcgatcttcgaccgcgagcccgac
tacgtcatttcgcccggcacctacgaccagaagcacattgcccgcatcggccacatctac
gactgcatcgcctatgggcccggcattctcgacctcgcccaccggccagacgaatgggtt
ggcatagaggacatggtggaatcggccaaggtgatggcgatcggcctcaacgtgctgctg
cgcggcacgaccggatga

DBGET integrated database retrieval system