KEGG   Mesorhizobium loti: mlr2005Help
Entry
mlr2005           CDS       T00043                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mlo  Mesorhizobium loti
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mlo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mlo00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mlo00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mlo00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:mlo00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1645589..1647268
Genome map
AA seq 559 aa AA seqDB search
MGRWAPPGRTDMTGLPRYEDAVARFRIEDEIARLDGDPLTGINGYVECCGRHTGQNRLAL
RAISAGGELRLFSFDDLADMSGRVGNLLKDAGVGPGDVVAGMLPRIPELIALILGTWRIG
AIYQPLFTAFGPKAIEHRLGYSGAKLVVTNPANRGKLDEMKTCPPIATILGPGDPLPAGD
IDFRAALAAASPDCEPVMRKGEDLFMMMSTSGTTGLPKGVPVPLNALLSFGAYIRDAIGL
RPDDVFWNIADPGWAYGLYYAITGPLLLGIATTFNEGAFNAGNTYDVIERLGVTSLAGSP
TAFRLLLAEGPEAAARIKGRLRVVSSAGEPLNPEVIRWFDAHLAAPIHDHYGQTENGMMV
NNHHGLAHAVRAGSAGFAMPGYRMVVLDDEGNELGLNQPGILAVDVANSPLRWFDGYHQA
ETPAIAGGYYRTGDTVEYEPDGSVSFIGRADDVITSSGYRIGPFDVESALIEHPAVNEAA
VVGVPDPQRTEIVKAFVILAPAYQGSTELAEELAQHVRKRLSAHAYPREIDFVAELPKTP
SGKIQRFLLRQAEVEKRKG
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggggagatgggcgccaccagggaggactgacatgaccggcttgccacgctacgaggac
gccgttgcgcgcttccgcatcgaggatgagatcgccaggctcgatggcgatcccctcacc
ggcatcaacggctatgtcgaatgctgcggccgccacaccgggcagaaccggctggcgctg
cgcgcgatctcggccgggggcgaactccggctgttcagcttcgacgacctcgctgatatg
tcgggccgcgtcggcaacctgctcaaggatgcaggcgtcgggcccggcgatgtcgtcgcc
ggcatgctgccgcgcattcccgaactcatagcgctcatcctcggcacctggcgcatcggc
gccatctaccagccgctgttcaccgctttcggcccgaaggcgatcgagcatcggctcggc
tatagcggcgcgaaattggtggtgaccaatccggccaatcgcggcaagctcgacgagatg
aagacctgcccgccgatcgccaccattcttggccccggcgatcccctgcccgctggcgac
atcgacttccgcgccgcgcttgccgccgcctcccctgactgcgaacccgtgatgcgcaaa
ggcgaggacctgttcatgatgatgtcgacctcgggcacgacgggcctgcccaagggcgtg
ccggtgccgctcaacgcgctgctctccttcggcgcctatatacgcgatgcgatcgggctg
cgccccgacgacgtcttctggaatatcgccgatcccggctgggcctatggcctctactac
gccatcactggcccgctgctgctcggcatcgccaccaccttcaacgagggcgccttcaac
gctgggaacacctatgacgtcatcgagcggctcggcgtcaccagccttgccggctcgccc
accgccttccgcctgctgctcgccgaagggcctgaggccgctgcccgcatcaagggccgg
ctgcgcgtggtgagcagcgccggcgagccgctcaacccggaagtgatccgctggttcgac
gctcatctcgccgcgcccattcacgaccattacggccagaccgagaacggcatgatggtc
aacaaccaccatggcctcgcgcatgccgtccgcgcgggctcggccggctttgccatgccg
ggttatcgcatggtggtgctggacgatgaaggcaacgagctcggcctcaatcagcccggc
atcctcgccgtcgatgtcgccaattcgccgctgcgctggttcgacggctaccaccaggcc
gagacgccggcgatcgcaggcggctactaccgcaccggcgacacggtggaatacgagccc
gacggctcggtctcctttatcggccgcgccgacgatgtcatcacctcgtcgggctaccgc
atcggccccttcgacgtcgaaagcgcgctgatcgaacatcccgcggtcaacgaggcggcg
gtggtcggcgtgcccgacccgcagcgcaccgagatcgtcaaggccttcgtcatcctggcg
ccggcctaccagggcagcacggaactcgccgaagaactggcgcagcatgtccgcaagcgg
ctctcggcccacgcctacccgcgcgagatcgatttcgtcgccgaattgccgaagacgccg
agcggcaagatccagcggttcctgctgcggcaggcggaggtggagaagcggaaggggtag

DBGET integrated database retrieval system