KEGG   Mesorhizobium loti: mlr2400Help
Entry
mlr2400           CDS       T00043                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mlo  Mesorhizobium loti
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mlo00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:mlo00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
1952891..1953661
Genome map
AA seq 256 aa AA seqDB search
MDKVVVVTGAASGIGKEIALTFARKGAKVVIADLDLDAAEETAREIDPAALRALGVGMDV
SNEDQVESGISRVVETFGRIDVLVSNAGVQTVAPLVEFDFDKWRKLLSIHLDGAFLTTRA
ALRQMYRQNSGSIIYMGSVHSKEASPFKAPYVTAKHGLIGLAKVVAKEGAAHGVRANVIC
PGFVRTPLVEKQIPEQARELGISPEDVVKTMMLRETVDGEFTTVQDVAETALFLAAFPSN
ALTGQSIVVSHGWFMQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggataaggtcgtggtagtcaccggagccgcgagtggtattggcaaagagatagccctt
accttcgcccgcaagggggcaaaggttgtcattgcggatcttgacctagacgcggccgag
gagacggcccgtgagatcgatccggccgctctgcgcgccctcggcgttggcatggacgtt
agcaacgaggatcaagtcgagagcggaatatcgcgggttgtcgaaaccttcggacgcatc
gacgtccttgtcagcaacgctggcgtccagaccgtcgcgccgctcgtcgaattcgatttc
gacaaatggaggaagttgctttcgatccacctggatggagccttcctgaccacccgtgct
gccttgcggcaaatgtaccgacagaacagcggcagcatcatttacatgggatccgtccac
tccaaggaggcgtctccgttcaaggctccctatgtcaccgccaagcacggcttgattggc
ctggccaaggtcgtggccaaggagggcgccgcccatggcgtccgcgccaacgtgatctgc
cctggattcgtccgcacgccgctggtggaaaaacagatcccggaacaggcgcgcgagctc
ggaatctctcccgaagacgtggtcaagacaatgatgctgagggaaacggtcgacggtgaa
ttcacgaccgtgcaggacgtcgcggaaacagcgctgttccttgcggcgttcccgtcgaac
gcactgaccggccagtcgatcgtggtgagtcacgggtggttcatgcagtag

DBGET integrated database retrieval system