KEGG   Mesorhizobium japonicum MAFF 303099: mlr2400Help
Entry
mlr2400           CDS       T00043                                 

Definition
(GenBank) beta-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00072  Synthesis and degradation of ketone bodies
mlo00650  Butanoate metabolism
mlo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    mlr2400
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    mlr2400
Enzymes [BR:mlo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     mlr2400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase 3HCDH_N DUF1776 CbiA
Motif
Other DBs
NCBI-ProteinID: BAB49541
RhizoBase: mlr2400
UniProt: Q98IH5
Position
1952891..1953661
Genome map
AA seq 256 aa AA seqDB search
MDKVVVVTGAASGIGKEIALTFARKGAKVVIADLDLDAAEETAREIDPAALRALGVGMDV
SNEDQVESGISRVVETFGRIDVLVSNAGVQTVAPLVEFDFDKWRKLLSIHLDGAFLTTRA
ALRQMYRQNSGSIIYMGSVHSKEASPFKAPYVTAKHGLIGLAKVVAKEGAAHGVRANVIC
PGFVRTPLVEKQIPEQARELGISPEDVVKTMMLRETVDGEFTTVQDVAETALFLAAFPSN
ALTGQSIVVSHGWFMQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggataaggtcgtggtagtcaccggagccgcgagtggtattggcaaagagatagccctt
accttcgcccgcaagggggcaaaggttgtcattgcggatcttgacctagacgcggccgag
gagacggcccgtgagatcgatccggccgctctgcgcgccctcggcgttggcatggacgtt
agcaacgaggatcaagtcgagagcggaatatcgcgggttgtcgaaaccttcggacgcatc
gacgtccttgtcagcaacgctggcgtccagaccgtcgcgccgctcgtcgaattcgatttc
gacaaatggaggaagttgctttcgatccacctggatggagccttcctgaccacccgtgct
gccttgcggcaaatgtaccgacagaacagcggcagcatcatttacatgggatccgtccac
tccaaggaggcgtctccgttcaaggctccctatgtcaccgccaagcacggcttgattggc
ctggccaaggtcgtggccaaggagggcgccgcccatggcgtccgcgccaacgtgatctgc
cctggattcgtccgcacgccgctggtggaaaaacagatcccggaacaggcgcgcgagctc
ggaatctctcccgaagacgtggtcaagacaatgatgctgagggaaacggtcgacggtgaa
ttcacgaccgtgcaggacgtcgcggaaacagcgctgttccttgcggcgttcccgtcgaac
gcactgaccggccagtcgatcgtggtgagtcacgggtggttcatgcagtag

DBGET integrated database retrieval system