KEGG   Mesorhizobium loti: mlr2752Help
Entry
mlr2752           CDS       T00043                                 

Definition
cytochrome C2
Orthology
K08738  
cytochrome c
Organism
mlo  Mesorhizobium loti
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    mlr2752
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    mlr2752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2209217..2209606
Genome map
AA seq 129 aa AA seqDB search
MLRAVSSASLLLIATSIAAHAGDDPVQGKHVFNRCVACHEAATDRDKVGPHLKGVVGRTA
GTAESFLGHYSEAMKSAGAAGLVWDEANLTEYLRAPKLKVPGNKMAFGGLTNDDDIANVI
AYLKADPKP
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgagccgtttcctcagccagccttcttctcattgccacttccattgccgcccat
gccggcgacgacccggtgcaaggcaagcacgtcttcaaccgctgcgtggcctgccatgag
gcggccaccgaccgcgacaaggtcggcccgcatctgaagggtgtggtcggacgcaccgcc
ggcacagccgagagcttccttggccattattccgaagccatgaagagtgcgggcgctgcc
ggtctcgtctgggacgaggcaaatctcaccgaatatctcagggcacccaagctcaaggtt
cccggcaacaaaatggcttttggtggcctgacgaatgatgacgacatcgccaatgtcatc
gcctatctgaaggccgatccgaagccctga

DBGET integrated database retrieval system