KEGG   Mesorhizobium japonicum MAFF 303099: mlr3160Help
Entry
mlr3160           CDS       T00043                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00240  Pyrimidine metabolism
mlo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    mlr3160
Enzymes [BR:mlo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     mlr3160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: BAB50111
RhizoBase: mlr3160
UniProt: Q98GV5
Position
2530917..2532236
Genome map
AA seq 439 aa AA seqDB search
MLPQEIIRHKRDGHRLSAGEIAAFIGGVTSGAVTDGQAAAFAMAVFFNGMNRDEAVALTL
AMRDSGDVLDWSDLPGPVTDKHSTGGVGDNVSLMLAPIVAACGAYVPMISGRGLGHTGGT
LDKMDAIPGYISQPDIALFRQAVLETGCAIIGQTADLAPADRRLYAIRDVTGTVESVPLI
TASILSKKLAAGLGSLVLDVKVGNGAFMERSRDATALANSLVEVASGAGLKVSALITGMN
EPLASAAGNAVEVHNAVDFLTGRLRDRRLEDVTLALAAEMLQSTGLVSSNQDGLRRATET
LTSGRAAATFARMVAVLGGPADFIEKPEKYLAVAPTEFAVRATTDGFVTGIATRDIGLAV
VGLGGGRTRPDDKIDPSVGITRLLPIGAEVHAGDALALVHARSPADAEAAAATVVSAYAI
GASKPAADKTVMRRILPRG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcttccgcaggaaatcatccgccacaagcgagacggccacaggctctcggccggtgaa
atcgctgccttcatcggcggcgttacctcgggcgccgtcaccgacggccaggccgcggct
ttcgccatggcggtgttcttcaacggcatgaatcgcgacgaggccgtggcgttgacgctg
gccatgcgcgattccggcgacgtgctcgactggtcggacctgcccggcccggtcaccgac
aaacattcgaccggcggcgtcggcgacaatgtctcgctgatgctggcgccgatcgtcgcc
gcctgcggcgcctatgtgccgatgatctcaggccgtggccttggccataccggcggcacg
ctggacaagatggatgcgatccccggctacatcagccagcccgatatcgcgttgtttcgc
caggcggtgctggaaaccggctgcgccatcatcggccagaccgccgatctggcgcccgcc
gaccgccgtctctatgccatccgcgacgtcaccggcaccgtggaatcggtgccgctgatc
actgcctcgatcctgtcgaagaagctggccgccggactgggctcgctggtgctcgacgtc
aaggtcggcaatggcgccttcatggagaggtcgcgcgacgcgaccgcgctcgccaacagt
ctcgtcgaggtcgccagtggcgccggactgaaggtctcggcactgatcaccggcatgaac
gaaccgctggcctcggccgccggcaatgccgtcgaggtgcacaacgccgtcgatttcctg
accggccgcctgcgcgaccgacggctggaggacgtgacgctggcgctggccgccgaaatg
ctgcagtcgacgggactggtgtcgtccaaccaggacggcttgcggcgcgccaccgagacg
ctcaccagcggccgcgccgcggccactttcgcacgtatggtggcggtgcttggcggcccc
gccgatttcatcgagaagccggaaaaatatttggccgtggcgccaacggaattcgcggtc
agggcgacgacggacggcttcgtcaccggcatcgccacgcgcgacatcggccttgcggtg
gtcggcctgggcggcgggcgcacgaggcctgacgacaagatcgaccccagcgtcggtatc
acccggctgctgcccataggcgcggaagtccatgccggagacgcgctggcactggtccac
gcccgctcacccgccgatgccgaggcggcggccgcgactgtggtttcggcctatgcgatc
ggcgcctcgaaaccagcggcggacaaaaccgtcatgcggcggatcctgccgcgcggttga

DBGET integrated database retrieval system