KEGG   Mesorhizobium loti: mlr3412Help
Entry
mlr3412           CDS       T00043                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mlo  Mesorhizobium loti
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    mlr3412
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mlr3412
   00052 Galactose metabolism
    mlr3412
   00500 Starch and sucrose metabolism
    mlr3412
   00520 Amino sugar and nucleotide sugar metabolism
    mlr3412
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    mlr3412
   00524 Butirosin and neomycin biosynthesis
    mlr3412
Enzymes [BR:mlo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     mlr3412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
2739829..2741277
Genome map
AA seq 482 aa AA seqDB search
MQDGMPLSIGIDIGGTNLRAARISGTGEIIKRVSEKSAPDPELVLGRIADMVRLLDTPDV
KAIGVGVPGRVDARRGAVLSGGYVNLASVALAQRLEDMTGKPVIIDNDCNMALAAEMALG
AGRGHGNIVMFTIGTGIGGAVAQDRRITRGSATAGQLGHITVDVNGEVCACGRRGCVETT
SSGTALGRHIARAGLGTDISVDQLFARDAAGDIQARGVLDAWAKPLRAAIDTAVAMLAPD
LVLLGGGLGRAAHAALGRAPALAPWYQCQVEAAQLGDDAGVIGAGLQALAAEPHLSPSTQ
SSRPLRAVLVNGIPASGKSTVSRGIADRMDWPLLALDTIKNPFLEVLGGGDRLFNRTLGR
ASYQAIWSVVGEAPAGTTFIVDAWFGFQPREVLEDHLRKAGVEQTFEIWCHAPGEVLAER
YGARLDLRPAGHPGAAYIPELIELAKRAEPLRRGPFFDVDTTKPIDFDTITAWLRATMDG
RA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacggcatgcctctcagcataggaatagatatcggcggcaccaatctgcgtgcc
gcccgcatttccggcaccggtgaaatcatcaagcgcgtttccgaaaaaagcgcgccggac
ccggagctggtgctcggccgcatcgccgacatggtgcgccttctcgacacgccggatgtg
aaggccatcggcgtcggcgttccaggccgcgtcgatgcgcggcgcggcgcggtgctgtcg
ggcggctatgtcaacctcgcctcggtcgcgctggcgcagcgcctggaagacatgacaggc
aagcctgtcatcatcgacaacgactgcaacatggcgctggccgccgagatggcgctcggc
gccgggcgcggccatggcaacatcgtcatgttcaccatcggcaccggcattggcggcgcc
gtcgcccaggatcggcggatcacgcgtggttcggcaacggcgggccagctcggccacatc
accgtcgacgtcaatggcgaggtctgcgcctgcggccggcgcggctgcgtcgaaaccacc
agttcgggcaccgcgctcggccgtcacattgcgcgcgccgggctcggcaccgacatttcg
gtcgatcagctctttgcccgcgatgcagccggcgatattcaggcgcgcggcgtactggac
gcctgggcgaaaccgctgcgggccgccatcgacaccgccgttgccatgcttgctcccgat
ttggtgctgcttggcggcggccttggccgggcggcccatgcagcactcggccgagcgccg
gcgctggcaccctggtaccaatgccaggtcgaagcagcacaactcggtgacgatgccggc
gtgatcggcgccggcctccaggccctggcggcggaaccgcacctttcgccctcgacccag
tccagccgcccgcttcgcgccgtgctcgtcaacggcatccccgccagcggcaagagcacc
gtctcgcgcggcatcgccgatcgcatggactggccgctgttggcgctcgacacgatcaag
aaccccttcctcgaagtactcggcggcggcgaccgcctgttcaaccgcacgctcggccgc
gccagctaccaggcaatctggtcggtcgtcggcgaagcccctgccggcaccaccttcatc
gtcgatgcctggttcggcttccagccgcgggaggttctcgaggatcatctgagaaaggca
ggcgtcgagcagactttcgaaatctggtgccatgcaccaggcgaggtgctcgccgagcgc
tacggcgcccggctcgacctgcgtcccgccggccatcccggtgcggcctatatccccgaa
ttgatcgaactcgccaaacgcgccgagccgctgcggcgcggaccgttcttcgacgtcgac
acgacgaaaccgatcgacttcgataccatcacggcctggttgcgagcgacgatggacggc
cgcgcatag

DBGET integrated database retrieval system