KEGG   Mesorhizobium japonicum MAFF 303099: mlr4089Help
Entry
mlr4089           CDS       T00043                                 

Definition
(GenBank) acetyl-CoA synthase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00010  Glycolysis / Gluconeogenesis
mlo00620  Pyruvate metabolism
mlo00640  Propanoate metabolism
mlo00680  Methane metabolism
mlo01100  Metabolic pathways
mlo01110  Biosynthesis of secondary metabolites
mlo01120  Microbial metabolism in diverse environments
mlo01130  Biosynthesis of antibiotics
mlo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mlr4089
   00620 Pyruvate metabolism
    mlr4089
   00640 Propanoate metabolism
    mlr4089
  Energy metabolism
   00680 Methane metabolism
    mlr4089
Enzymes [BR:mlo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     mlr4089
Lipid biosynthesis proteins [BR:mlo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   mlr4089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: BAB50829
RhizoBase: mlr4089
UniProt: Q98ET8
Position
3268373..3270328
Genome map
AA seq 651 aa AA seqDB search
MSEVHVHRVQPAWKKNALIDNDTYLKWYADSIKNPDKFWGKHGKRIDWFKPFSKVKNTSF
DGKVSIKWFEDGLTNVSYNCIDRHLKKRGDQTAIIWEGDNPYDDKKITYNELYERVCRLA
NVMKKHGVKKGDRVTIYMPMIPEAAYAMLACTRIGAIHSIVFGGFSPDALAGRIVDCEST
FVITADEGLRGGKSIPLKENTDKAIDIAAKNFVMVKNVLVVRRTGGKVGWAPGRDLWYHD
EVATVKAECKPEKMKAEDPLFILYTSGSTGKPKGVLHTTAGYLVYASMTHQYVFDYHDGD
IYWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPNYPSQSRFWEVIDKHKVNIFYTAPT
ALRALMGAGNDPVKKTSRKSLRVLGSVGEPINPEAWEWYFNVVGNGKVPIVDTWWQTETG
GILITPLPGATDLKAGSATRPFFGVKPQLVDGEGKVLEGAADGNLCITDSWPGQMRTVYG
DHDRFVQTYFSTYKGKYFTGDGCRRDADGYYWITGRVDDVINVSGHRMGTAEVESALVSH
DKVSEAAVVGYPHDIKGQGIYSYVTLMKGEEPTEDLRKELIAHVRKEIGAIASPDKIQFA
PGLPKTRSGKIMRRILRKIAEDDFSTLGDTSTLADPAVVDDLIANRQNKKG
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggttcatgtccatcgcgtccagccggcgtggaagaagaatgcgctgatcgac
aacgacacgtacctgaaatggtatgccgacagcatcaagaacccggacaagttctggggc
aagcacggcaagcgcatcgactggttcaagcccttcagcaaggtcaagaacacctccttc
gacggcaaggtctcgatcaaatggttcgaggacgggctgaccaatgtttcctacaactgc
atcgaccgccatctgaagaagcgcggcgaccagacggccatcatctgggaaggcgacaac
ccctacgacgacaagaagatcacctacaacgagctctacgagcgcgtttgccggctcgcc
aatgtgatgaagaagcacggcgtcaagaagggcgaccgcgtcaccatctacatgccgatg
atcccggaagccgcctatgcgatgctggcctgcacgcgtatcggcgccatccattcgatc
gtcttcggcggcttttcgcccgatgcgctggccggccgcatcgtcgactgcgaatcgacc
ttcgtcatcaccgccgatgaaggcctgcgcggcggcaagtcgattccgctgaaggagaac
accgacaaggcgatcgacatcgccgcgaagaacttcgtcatggtgaagaacgtcctcgtc
gtgcgccgcaccggcggcaaggtcggctgggcgccgggccgcgacctctggtatcacgac
gaggtcgcgacggtgaaggccgagtgcaagcccgagaagatgaaggcggaagacccgctg
ttcatcctttatacctcaggctcgaccggcaagccgaagggcgtgctgcacaccaccgcc
ggctatctcgtctatgcctcgatgacgcaccaatatgtcttcgactaccatgacggcgat
atctactggtgcaccgccgatgtcggctgggtgacgggccacagctacatcgtctatggc
ccgctcgcgaacggcgccaccacgctgatgttcgagggtgtgccgaattacccctcgcag
tcgcgcttctgggaagtcatcgacaagcacaaggtcaacatcttctacaccgccccgacg
gcgctgcgcgcgctgatgggcgccggcaacgacccggtgaagaagacctcgcgcaaatca
ctgcgtgtgctcggctcagtcggcgagccgatcaatccggaagcctgggagtggtatttc
aacgtcgtcggcaacggcaaggtgccgatcgtcgacacatggtggcagaccgagaccggc
ggcatcctgatcacgccgctgccaggcgccaccgacctcaaggcaggctcggcgacgcgg
cccttcttcggagtcaagccgcagctagtcgacggcgaaggcaaggtgctggaaggagcc
gccgacggcaatctttgcatcaccgattcctggccgggccagatgcgcaccgtctatggc
gatcacgaccgcttcgtgcagacctatttctccacctacaagggcaagtacttcaccggc
gacggctgccgccgcgacgccgacggctactactggatcaccggccgcgtcgacgacgtc
atcaacgtctccggccaccgcatgggcacggccgaggtcgaatcggcgctggtgagccat
gacaaggtctcggaggccgccgtcgtcggctacccccacgacattaagggccagggcatt
tacagctacgtcaccttgatgaagggcgaggaaccgaccgaggatctgcgcaaggagctc
atcgcccatgtccgcaaggagatcggcgccatcgcctcgcccgacaagatccagttcgcc
cctggcctgcccaagacacgttccggcaagatcatgcgccgcatcctgcgcaagatcgcc
gaggacgatttttctacccttggcgacacctcgacgctcgccgatccggccgtcgtcgac
gacctcatcgccaaccggcagaacaagaagggctga

DBGET integrated database retrieval system