KEGG   Mesorhizobium loti: mlr4089Help
Entry
mlr4089           CDS       T00043                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mlo  Mesorhizobium loti
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    mlr4089
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mlr4089
   00620 Pyruvate metabolism
    mlr4089
   00640 Propanoate metabolism
    mlr4089
  Energy metabolism
   00680 Methane metabolism
    mlr4089
Enzymes [BR:mlo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     mlr4089
Lipid biosynthesis proteins [BR:mlo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   mlr4089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3268373..3270328
Genome map
AA seq 651 aa AA seqDB search
MSEVHVHRVQPAWKKNALIDNDTYLKWYADSIKNPDKFWGKHGKRIDWFKPFSKVKNTSF
DGKVSIKWFEDGLTNVSYNCIDRHLKKRGDQTAIIWEGDNPYDDKKITYNELYERVCRLA
NVMKKHGVKKGDRVTIYMPMIPEAAYAMLACTRIGAIHSIVFGGFSPDALAGRIVDCEST
FVITADEGLRGGKSIPLKENTDKAIDIAAKNFVMVKNVLVVRRTGGKVGWAPGRDLWYHD
EVATVKAECKPEKMKAEDPLFILYTSGSTGKPKGVLHTTAGYLVYASMTHQYVFDYHDGD
IYWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPNYPSQSRFWEVIDKHKVNIFYTAPT
ALRALMGAGNDPVKKTSRKSLRVLGSVGEPINPEAWEWYFNVVGNGKVPIVDTWWQTETG
GILITPLPGATDLKAGSATRPFFGVKPQLVDGEGKVLEGAADGNLCITDSWPGQMRTVYG
DHDRFVQTYFSTYKGKYFTGDGCRRDADGYYWITGRVDDVINVSGHRMGTAEVESALVSH
DKVSEAAVVGYPHDIKGQGIYSYVTLMKGEEPTEDLRKELIAHVRKEIGAIASPDKIQFA
PGLPKTRSGKIMRRILRKIAEDDFSTLGDTSTLADPAVVDDLIANRQNKKG
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggttcatgtccatcgcgtccagccggcgtggaagaagaatgcgctgatcgac
aacgacacgtacctgaaatggtatgccgacagcatcaagaacccggacaagttctggggc
aagcacggcaagcgcatcgactggttcaagcccttcagcaaggtcaagaacacctccttc
gacggcaaggtctcgatcaaatggttcgaggacgggctgaccaatgtttcctacaactgc
atcgaccgccatctgaagaagcgcggcgaccagacggccatcatctgggaaggcgacaac
ccctacgacgacaagaagatcacctacaacgagctctacgagcgcgtttgccggctcgcc
aatgtgatgaagaagcacggcgtcaagaagggcgaccgcgtcaccatctacatgccgatg
atcccggaagccgcctatgcgatgctggcctgcacgcgtatcggcgccatccattcgatc
gtcttcggcggcttttcgcccgatgcgctggccggccgcatcgtcgactgcgaatcgacc
ttcgtcatcaccgccgatgaaggcctgcgcggcggcaagtcgattccgctgaaggagaac
accgacaaggcgatcgacatcgccgcgaagaacttcgtcatggtgaagaacgtcctcgtc
gtgcgccgcaccggcggcaaggtcggctgggcgccgggccgcgacctctggtatcacgac
gaggtcgcgacggtgaaggccgagtgcaagcccgagaagatgaaggcggaagacccgctg
ttcatcctttatacctcaggctcgaccggcaagccgaagggcgtgctgcacaccaccgcc
ggctatctcgtctatgcctcgatgacgcaccaatatgtcttcgactaccatgacggcgat
atctactggtgcaccgccgatgtcggctgggtgacgggccacagctacatcgtctatggc
ccgctcgcgaacggcgccaccacgctgatgttcgagggtgtgccgaattacccctcgcag
tcgcgcttctgggaagtcatcgacaagcacaaggtcaacatcttctacaccgccccgacg
gcgctgcgcgcgctgatgggcgccggcaacgacccggtgaagaagacctcgcgcaaatca
ctgcgtgtgctcggctcagtcggcgagccgatcaatccggaagcctgggagtggtatttc
aacgtcgtcggcaacggcaaggtgccgatcgtcgacacatggtggcagaccgagaccggc
ggcatcctgatcacgccgctgccaggcgccaccgacctcaaggcaggctcggcgacgcgg
cccttcttcggagtcaagccgcagctagtcgacggcgaaggcaaggtgctggaaggagcc
gccgacggcaatctttgcatcaccgattcctggccgggccagatgcgcaccgtctatggc
gatcacgaccgcttcgtgcagacctatttctccacctacaagggcaagtacttcaccggc
gacggctgccgccgcgacgccgacggctactactggatcaccggccgcgtcgacgacgtc
atcaacgtctccggccaccgcatgggcacggccgaggtcgaatcggcgctggtgagccat
gacaaggtctcggaggccgccgtcgtcggctacccccacgacattaagggccagggcatt
tacagctacgtcaccttgatgaagggcgaggaaccgaccgaggatctgcgcaaggagctc
atcgcccatgtccgcaaggagatcggcgccatcgcctcgcccgacaagatccagttcgcc
cctggcctgcccaagacacgttccggcaagatcatgcgccgcatcctgcgcaagatcgcc
gaggacgatttttctacccttggcgacacctcgacgctcgccgatccggccgtcgtcgac
gacctcatcgccaaccggcagaacaagaagggctga

DBGET integrated database retrieval system