KEGG   Mesorhizobium loti: mlr4205Help
Entry
mlr4205           CDS       T00043                                 

Definition
glucan 1,4-alpha-glucosidase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
mlo  Mesorhizobium loti
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    mlr4205
Enzymes [BR:mlo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     mlr4205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3358246..3360660
Genome map
AA seq 804 aa AA seqDB search
MAVTPIVPPGAPGIPARWTSSAKSGVGTSLSPAGHIWFTISHGILEVYYPRLDSACTRDL
GLIVTGPGGYFSEEKRDAAHEIEPFEAGVPAYRLVNTAGDGAYRIEKRILCDPARPVLLQ
EITFTALKGAPDDYRVYALLAPHLVNAGMGNTAWVGDHKGKPVLFASGRGSCLALASSLP
WRDCSAGYVGFSDGWQQLNHTGILDQACQRAEDGNVALTGEIGFTSTTTKAVLALGFGAT
PDEAAENAFASLEQGFEPAAKTYLQNWREWQARLLPLDRHAASGINTYRTSTAVLATHRS
IAMPGAAVASLSIPWGFNKGDDDLGGYHLVWPRDLVETAGGFLAAGDAASALQILEYLRS
IQQPDGHWPQNAWLDGSAYWPGIQMDECAFPLLLADALHRAGHLPRARLATLLPMIERAA
TYVVRNGPVTGEDRWEEDAGYSPFTLAVEIAALLAAADLLDACGKKDEATYLRETSDGWN
DQLERWTYATDTAICRAAGVEGYYVRIAPPDSAEAGSPKDGYVPIKNRPPGDTDRPAQEI
VSPDALALVRFGLRSADDPRIVDTVKVIDAQLRCALPQGPIWYRYNGDGYGEHQDGTPFD
GTGQGRPWPLLAGERAHYELAAGRKDEAANLLKALEDSAEPGGLLPEQVWDGADLPERQL
LHGRPSGSAMPLVWAHSEHIKLLRSLRDGAVFDMPPQGVKRYIEAKTVSPFRTWRFNNKI
RALPEGKTLRIELLAAATVHWSTDNWATAHDSQTVENAFGIHLADLPTTSLPEGSALIFT
FFWPGTGDWENVDFSVTSGERDSG
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgacgccgatcgttcccccgggcgcaccgggcattccggcgcgctggacatcg
agcgccaagagcggcgtcgggacgtcgctttcgccggccggccacatctggttcaccatc
agccacggcatcctcgaagtctactatccacggctcgacagcgcctgcacgcgcgatctc
ggcctgatcgtcaccggtcccggcggctatttctccgaagagaagcgcgatgccgcgcat
gaaatcgagcccttcgaggccggcgtgcccgcctaccggctggtcaacacggccggcgac
ggcgcctaccgcatcgagaagcgcatcctctgcgaccctgcgcggcccgtgctgctgcag
gaaatcaccttcacggcgcttaaaggtgcgcccgacgattaccgcgtctacgcgcttctg
gcgccgcatctggtcaatgccggcatgggcaacaccgcctgggtcggcgaccacaaggga
aagcccgtgctgttcgcctcgggccgcggctcttgcctggcgctggcctcgtcgctgccc
tggcgggactgttcagccggctatgtcggcttctccgacggctggcagcagctcaatcat
accggcatccttgatcaggcttgccaacgggcggaagacggtaatgtcgcactgaccggc
gagatcggctttacatcaacaacgacaaaagccgtgctggcgctgggtttcggcgcgaca
ccggacgaggccgccgaaaatgccttcgccagtctggaacagggctttgagcccgcagcc
aagacctacctccagaattggcgcgaatggcaggcgcggctgctgcccctggaccggcac
gcggcatccggcatcaacacctatcgcacctcgaccgcggttctggcgacgcaccgctcc
atcgccatgccgggcgcggcggtcgcaagcctgtccattccctggggcttcaacaagggc
gacgacgaccttggcggctaccatctggtctggccgcgcgatctggtcgagactgcgggc
ggcttcctcgccgccggcgacgccgcctcggcgctgcagatccttgagtatctgcgctcc
atccagcagccggacggccattggccgcaaaatgcctggctcgacgggtcggcctattgg
cccggcatccagatggacgagtgcgcctttccgctgcttctggccgacgccttgcaccgc
gccggccatctgccgcgcgccaggcttgccaccttactgccgatgatcgaacgcgccgcg
acctatgtcgtgcgcaatggacccgtcaccggcgaagaccgctgggaagaggatgccggc
tacagcccgttcacgcttgccgtcgagatcgccgccctgcttgctgcggccgacctgctc
gacgcctgcggcaagaaggacgaagcaacctatctgcgcgagacatcagatggctggaac
gaccagcttgagcgctggacctatgccaccgacacggcgatctgcagggcagccggcgtc
gaaggttattatgtccgtatcgcgccacccgacagcgccgaggccggctcgcccaaggac
ggctatgtcccgatcaagaaccggccgcccggcgacaccgaccgcccggcgcaggaaatc
gtcagccccgacgcgctggcgctggtgcgctttggcctgaggtcggccgacgacccgcgc
atcgtcgacacagtcaaggtcatcgacgcgcagttgcgctgcgcgctgccgcagggcccg
atctggtatcgatacaatggcgacggctatggcgaacaccaggacggcacgcctttcgac
ggtaccggccagggccggccctggccgcttctggccggcgagcgcgcccattatgagctg
gcggcggggcgcaaggatgaggcggccaacctgctcaaggcgctggaggattcggccgag
ccgggcggcctgctgccggagcaggtctgggatggcgccgacctgcccgagcgccaattg
ctgcatggccgcccctcgggcagcgccatgcccctggtctgggcgcactccgagcatatc
aagctgctgcgctcgctgcgcgacggcgccgtcttcgacatgccgccgcaaggcgtgaag
cgctacatcgaggccaagaccgtatcgccattcaggacctggcgcttcaacaacaagatc
cgcgcgctgcccgaaggcaagacgctgcgcatcgaattgctggccgcggccacggtgcat
tggagcaccgacaattgggcaaccgcccatgacagccagacggtggaaaatgccttcggc
atccatcttgccgatttgcccacgaccagcctccccgagggaagcgcgctgatcttcact
tttttctggcccggaaccggcgattgggagaatgtcgacttctccgtcacatcaggcgag
cgggatagcggctaa

DBGET integrated database retrieval system