KEGG   Mesorhizobium loti: mlr4209Help
Entry
mlr4209           CDS       T00043                                 

Definition
phosphate glucokinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
mlo  Mesorhizobium loti
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:mlo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mlo00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mlo00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3363122..3363844
Genome map
AA seq 240 aa AA seqDB search
MSGGDAMAKAVKQPAPDAEQIVLAIDIGGSHVKILTSAGGAERRDDSGPDLTPQQMIDKV
KKLAEGLSYDVISMGYPGPVRHNKPVLDPKNLGKGWAGFDFAAQFGKPVKVVNDALMQAI
GSYEGGRMLFLGLGTGLGAAMVFDNVGQPMELAHLPYRKGRSFEDYVGERGLEKRGKKKW
RKYVFDVVTRLRAALQPDYVVIGGGNVDKLDALPAEARRGDNTRAFEGGFRLWRDKALIV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaggggacgcgatggccaaggcggtgaagcaaccggcacccgacgccgagcag
atcgttctggcgatcgacattggcggctcgcacgtcaagatcctgaccagcgccggcggc
gccgagcgccgggacgattccggcccggacctgacgccgcagcagatgatcgacaaggtg
aagaaactcgccgagggcctgtcctacgacgtcatctcgatgggctatcccggcccggtg
cgtcacaacaagccggtgctcgaccccaagaatctcggcaagggctgggccggcttcgat
ttcgccgcgcaattcggcaagccggtcaaggtggtcaatgatgcgctgatgcaggccatc
ggcagctatgaaggcgggcgcatgctgttcctcgggctgggaaccggcctcggcgcggcg
atggtcttcgacaatgtcggccagccgatggaactcgcccatcttccctacagaaaaggc
cgcagtttcgaggactatgtcggcgagcgcggcctggaaaagcgcggcaagaagaagtgg
cgcaaatacgtcttcgacgtcgtcacccggctgcgcgccgccctgcaaccagactatgtc
gtcattggcggcggcaatgtcgacaagctcgacgcgttaccagccgaggccaggcgcggt
gacaacacacgcgccttcgaaggcggatttcgtctgtggcgagacaaggccctgattgtc
tga

DBGET integrated database retrieval system