KEGG   Mesorhizobium loti: mlr4209Help
Entry
mlr4209           CDS       T00043                                 

Definition
phosphate glucokinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
mlo  Mesorhizobium loti
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    mlr4209
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mlr4209
   00520 Amino sugar and nucleotide sugar metabolism
    mlr4209
Enzymes [BR:mlo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     mlr4209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3363122..3363844
Genome map
AA seq 240 aa AA seqDB search
MSGGDAMAKAVKQPAPDAEQIVLAIDIGGSHVKILTSAGGAERRDDSGPDLTPQQMIDKV
KKLAEGLSYDVISMGYPGPVRHNKPVLDPKNLGKGWAGFDFAAQFGKPVKVVNDALMQAI
GSYEGGRMLFLGLGTGLGAAMVFDNVGQPMELAHLPYRKGRSFEDYVGERGLEKRGKKKW
RKYVFDVVTRLRAALQPDYVVIGGGNVDKLDALPAEARRGDNTRAFEGGFRLWRDKALIV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaggggacgcgatggccaaggcggtgaagcaaccggcacccgacgccgagcag
atcgttctggcgatcgacattggcggctcgcacgtcaagatcctgaccagcgccggcggc
gccgagcgccgggacgattccggcccggacctgacgccgcagcagatgatcgacaaggtg
aagaaactcgccgagggcctgtcctacgacgtcatctcgatgggctatcccggcccggtg
cgtcacaacaagccggtgctcgaccccaagaatctcggcaagggctgggccggcttcgat
ttcgccgcgcaattcggcaagccggtcaaggtggtcaatgatgcgctgatgcaggccatc
ggcagctatgaaggcgggcgcatgctgttcctcgggctgggaaccggcctcggcgcggcg
atggtcttcgacaatgtcggccagccgatggaactcgcccatcttccctacagaaaaggc
cgcagtttcgaggactatgtcggcgagcgcggcctggaaaagcgcggcaagaagaagtgg
cgcaaatacgtcttcgacgtcgtcacccggctgcgcgccgccctgcaaccagactatgtc
gtcattggcggcggcaatgtcgacaagctcgacgcgttaccagccgaggccaggcgcggt
gacaacacacgcgccttcgaaggcggatttcgtctgtggcgagacaaggccctgattgtc
tga

DBGET integrated database retrieval system