KEGG   Mesorhizobium loti: mlr4347Help
Entry
mlr4347           CDS       T00043                                 

Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mlo  Mesorhizobium loti
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:mlo01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3457593..3458309
Genome map
AA seq 238 aa AA seqDB search
MEREGSVCRKPSPGRILWSYGACRMSFKRQIAAGLILFLALCGAISSARAEPFKIVGFGD
SLTAGYGLGPGEGFTDKLQAALRAKGRDVTVANAGVSGDTTSGGLARLDWSVPDGTRLVI
LELGANDMLRGVLPDIARKNLDEMLARLKQRKIAVLLAGMRAAPNLGADYQTAFDAIFPE
LAKKYDVALYPFFLDGVAGQPGMQLEDGLHPSAKGVDLMVERILPTVEKAIAAVPGGA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtgaaggctctgtttgccggaagccgtcgcccggaagaatcctttggtcatat
ggggcctgccgcatgtctttcaaacgccagatagccgcaggcttgatccttttcctcgcc
ctttgcggcgccatttcgtcggcgcgggccgaacccttcaagatcgtcggcttcggcgac
agcctgacggcgggatacggtctcgggcccggcgagggttttaccgacaagctccaggcc
gcacttcgggccaaaggccgtgatgtcaccgtcgccaatgccggtgtttccggcgacacc
accagcggcggcctggcgcggctcgactggtcggtgccggacggaacccggctggtcatc
ctcgaactcggcgccaacgacatgctgcgcggcgttttgcccgatatcgccaggaagaac
ctcgacgagatgctggccaggctcaagcagcgcaagatcgccgtgcttctggccggcatg
cgcgccgcgcccaatctcggcgccgattaccagaccgccttcgacgccatcttcccggag
ctggcgaagaaatacgatgtcgcactctacccgttcttcctcgatggcgtcgccggccag
cccggcatgcagctcgaggatggcctgcatccgagcgccaaaggggtcgacctgatggtc
gagcgcatcctgccgacggtcgagaaggccattgcggcggtgcccggaggcgcgtga

DBGET integrated database retrieval system