KEGG   Mesorhizobium japonicum MAFF 303099: mlr4347Help
Entry
mlr4347           CDS       T00043                                 

Definition
(GenBank) acyl-CoA thioesterase
  KO
K10804  acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo01040  Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    mlr4347
Enzymes [BR:mlo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     mlr4347
   3.1.2  Thioester hydrolases
    3.1.2.-  
     mlr4347
Lipid biosynthesis proteins [BR:mlo01004]
 Fatty acid synthase
  Component type
   mlr4347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL OSK
Motif
Other DBs
NCBI-ProteinID: BAB51025
RhizoBase: mlr4347
UniProt: Q98E95
Position
3457593..3458309
Genome map
AA seq 238 aa AA seqDB search
MEREGSVCRKPSPGRILWSYGACRMSFKRQIAAGLILFLALCGAISSARAEPFKIVGFGD
SLTAGYGLGPGEGFTDKLQAALRAKGRDVTVANAGVSGDTTSGGLARLDWSVPDGTRLVI
LELGANDMLRGVLPDIARKNLDEMLARLKQRKIAVLLAGMRAAPNLGADYQTAFDAIFPE
LAKKYDVALYPFFLDGVAGQPGMQLEDGLHPSAKGVDLMVERILPTVEKAIAAVPGGA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtgaaggctctgtttgccggaagccgtcgcccggaagaatcctttggtcatat
ggggcctgccgcatgtctttcaaacgccagatagccgcaggcttgatccttttcctcgcc
ctttgcggcgccatttcgtcggcgcgggccgaacccttcaagatcgtcggcttcggcgac
agcctgacggcgggatacggtctcgggcccggcgagggttttaccgacaagctccaggcc
gcacttcgggccaaaggccgtgatgtcaccgtcgccaatgccggtgtttccggcgacacc
accagcggcggcctggcgcggctcgactggtcggtgccggacggaacccggctggtcatc
ctcgaactcggcgccaacgacatgctgcgcggcgttttgcccgatatcgccaggaagaac
ctcgacgagatgctggccaggctcaagcagcgcaagatcgccgtgcttctggccggcatg
cgcgccgcgcccaatctcggcgccgattaccagaccgccttcgacgccatcttcccggag
ctggcgaagaaatacgatgtcgcactctacccgttcttcctcgatggcgtcgccggccag
cccggcatgcagctcgaggatggcctgcatccgagcgccaaaggggtcgacctgatggtc
gagcgcatcctgccgacggtcgagaaggccattgcggcggtgcccggaggcgcgtga

DBGET integrated database retrieval system