KEGG   Mesorhizobium loti: mlr4640Help
Entry
mlr4640           CDS       T00043                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mlo  Mesorhizobium loti
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    mlr4640 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mlr4640 (glk)
   00052 Galactose metabolism
    mlr4640 (glk)
   00500 Starch and sucrose metabolism
    mlr4640 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    mlr4640 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    mlr4640 (glk)
   00524 Butirosin and neomycin biosynthesis
    mlr4640 (glk)
Enzymes [BR:mlo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     mlr4640 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3677994..3679019
Genome map
AA seq 341 aa AA seqDB search
MPSVSDTDTSLRFPILIGDIGGTNARFSIVLDANSEPTEPQIVQTANFNTIDEAIQAAVL
DRSSVRPNSAVLAVAGPVDGDEIELTNCPWVVKPRQMFANLGLSDIVVLNDFEAQALAVV
ALGEEHMEKIGGGTPEPNAGRVVLGPGTGLGVAGLVYALRHWIPVPGEGGHMDIGPRTPR
DFEVFPHIEKLEGRISGEQILCGRGLVNVYRAVAKADGKPAPFTTPAEITGAALAKTDPV
AEEALETFVTCLGRTAGDLALVFMSRGGVFLTGGIAQKIVPALKEGNFRAAFEDKAPHSA
LMRTMPVYVITHPLAALLGLAAYARNPSLFGVQTAGRRWQA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgccaagcgtaagcgataccgacacgtcgttgcggtttccgatcctgatcggcgacatt
ggcggcaccaatgcgcgcttttcgatcgtgctcgacgccaattccgagccgaccgagccg
cagatcgtccagaccgccaatttcaacacgatcgacgaggcgatccaggcggcggtgctc
gaccgctcgtcggtccgtcccaattcggcggtgctggcggtggccggtccggtcgacggc
gacgagatcgaactcaccaattgcccgtgggtcgtcaagcccaggcagatgtttgccaat
ctcggcttgagcgacattgtcgtgctcaacgatttcgaggcgcaggcgctggccgtcgtg
gcgcttggcgaagagcatatggaaaagatcggcggcggcacgccggagcccaatgcaggc
cgcgtcgtgctcggccccggaaccgggctcggcgtcgccgggctggtctatgccttgcgc
cactggataccggtgcccggcgaaggcggccatatggacatcggtccgcgcacgccgcgc
gatttcgaggtgtttccgcatatcgagaagctcgagggccgcatttccggcgaacagatc
ctgtgcgggcgcggcctcgtcaacgtctaccgggctgtcgccaaggcggacggcaagccg
gcgcctttcaccacgccggccgagatcaccggcgcggcgctggccaagaccgatccggtg
gctgaggaagcgctggagactttcgtcacctgcctcgggcgcaccgccggcgatcttgcc
ctggtgttcatgagccgtggcggcgtcttcttgaccggcgggatcgcccaaaaaatcgtg
ccggcgctgaaggagggcaatttccgcgccgccttcgaggacaaggcgccgcacagcgcg
ctgatgcgcaccatgcccgtctatgtcatcacccatccgctggcggcccttctcggcctt
gccgcctatgccaggaacccgtcgctgttcggcgtccagacggccggccggcgctggcag
gcctga

DBGET integrated database retrieval system