KEGG   Mesorhizobium japonicum MAFF 303099: mlr4640Help
Entry
mlr4640           CDS       T00043                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00010  Glycolysis / Gluconeogenesis
mlo00052  Galactose metabolism
mlo00500  Starch and sucrose metabolism
mlo00520  Amino sugar and nucleotide sugar metabolism
mlo00521  Streptomycin biosynthesis
mlo01100  Metabolic pathways
mlo01110  Biosynthesis of secondary metabolites
mlo01120  Microbial metabolism in diverse environments
mlo01130  Biosynthesis of antibiotics
mlo01200  Carbon metabolism
Module
mlo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mlr4640
   00052 Galactose metabolism
    mlr4640
   00500 Starch and sucrose metabolism
    mlr4640
   00520 Amino sugar and nucleotide sugar metabolism
    mlr4640
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    mlr4640
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    mlr4640
Enzymes [BR:mlo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     mlr4640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: BAB51248
RhizoBase: mlr4640
UniProt: Q98DM2
Position
3677994..3679019
Genome map
AA seq 341 aa AA seqDB search
MPSVSDTDTSLRFPILIGDIGGTNARFSIVLDANSEPTEPQIVQTANFNTIDEAIQAAVL
DRSSVRPNSAVLAVAGPVDGDEIELTNCPWVVKPRQMFANLGLSDIVVLNDFEAQALAVV
ALGEEHMEKIGGGTPEPNAGRVVLGPGTGLGVAGLVYALRHWIPVPGEGGHMDIGPRTPR
DFEVFPHIEKLEGRISGEQILCGRGLVNVYRAVAKADGKPAPFTTPAEITGAALAKTDPV
AEEALETFVTCLGRTAGDLALVFMSRGGVFLTGGIAQKIVPALKEGNFRAAFEDKAPHSA
LMRTMPVYVITHPLAALLGLAAYARNPSLFGVQTAGRRWQA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgccaagcgtaagcgataccgacacgtcgttgcggtttccgatcctgatcggcgacatt
ggcggcaccaatgcgcgcttttcgatcgtgctcgacgccaattccgagccgaccgagccg
cagatcgtccagaccgccaatttcaacacgatcgacgaggcgatccaggcggcggtgctc
gaccgctcgtcggtccgtcccaattcggcggtgctggcggtggccggtccggtcgacggc
gacgagatcgaactcaccaattgcccgtgggtcgtcaagcccaggcagatgtttgccaat
ctcggcttgagcgacattgtcgtgctcaacgatttcgaggcgcaggcgctggccgtcgtg
gcgcttggcgaagagcatatggaaaagatcggcggcggcacgccggagcccaatgcaggc
cgcgtcgtgctcggccccggaaccgggctcggcgtcgccgggctggtctatgccttgcgc
cactggataccggtgcccggcgaaggcggccatatggacatcggtccgcgcacgccgcgc
gatttcgaggtgtttccgcatatcgagaagctcgagggccgcatttccggcgaacagatc
ctgtgcgggcgcggcctcgtcaacgtctaccgggctgtcgccaaggcggacggcaagccg
gcgcctttcaccacgccggccgagatcaccggcgcggcgctggccaagaccgatccggtg
gctgaggaagcgctggagactttcgtcacctgcctcgggcgcaccgccggcgatcttgcc
ctggtgttcatgagccgtggcggcgtcttcttgaccggcgggatcgcccaaaaaatcgtg
ccggcgctgaaggagggcaatttccgcgccgccttcgaggacaaggcgccgcacagcgcg
ctgatgcgcaccatgcccgtctatgtcatcacccatccgctggcggcccttctcggcctt
gccgcctatgccaggaacccgtcgctgttcggcgtccagacggccggccggcgctggcag
gcctga

DBGET integrated database retrieval system