KEGG   Mesorhizobium loti: mlr4664Help
Entry
mlr4664           CDS       T00043                                 

Definition
(GenBank) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
mlo  Mesorhizobium loti
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    mlr4664
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    mlr4664
   00630 Glyoxylate and dicarboxylate metabolism
    mlr4664
Enzymes [BR:mlo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     mlr4664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
Position
3698567..3700732
Genome map
AA seq 721 aa AA seqDB search
MTDRIEIAGLRIAGELHDFVAGEALPGTGIAADAFWSGFSAIVHDLAPKNRALLKKRDAM
QERLDGWYRDNGAPVDMEVYKSFLKEIGYLVPEGPAFSVSTDNVDPEIAVVAGPQLVVPV
MNARYALNAANARWGSLYDALYGTDAIPETGGAEKGKGFNPARGAKVIAWAKDFLDQSVP
LTSGKWAGVNGLSVAHGALKLGAGAGGTTLADPRQFAGYRGDAANPDAVLLVKNGLHIEI
VVDRNNQIGRTDPAGIADVILESALTTIQDCEDSVAAVDAQDKVVVYRNWLGLMKGDLAE
EISKAGRSFVRKLNADRAYTAPAGGQITVPGRSLMLVRNVGHLMTNPAILDRDGNEVPEG
IMDAALTALIALHDVGPEGRRANSRAGSMYVVKPKMHGPEEVAFAVEIFDRVEALLGMPR
NTIKMGIMDEERRTTVNLKEAIRAARERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMK
QAAWISAYEAWNVDTGLECGLAGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHKVDVHAVQAALKSRPKAKLDDILSVPVAVRPNWTPDEIQRELDNNAQG
ILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQHIANWLRHKVCSEIQVRDSLQR
MAAIVDRQNVGDPLYRPMAPDFDKSIAFQAACDLVFKGTSQPNGYTEPVLHARRLELKAQ
R
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgcatcgagatcgccggattgcggattgccggcgagctgcatgattttgtg
gctggcgaggccttgcccggcaccggcatcgccgccgatgcgttctggagcggtttttcg
gccatcgtccacgatctcgcgccgaagaaccgggcgctgctcaaaaaacgtgacgccatg
caggaaaggctcgacggctggtatcgcgacaatggcgcgccggtcgacatggaggtctac
aagagcttcctgaaagagatcggctatctcgttcccgaagggccggccttcagcgtgtcg
acggacaatgtcgatcccgaaatcgccgtcgttgccgggccgcagctcgtcgtgccggtg
atgaatgcgcgctatgcgctcaatgccgccaatgcgcgctggggctcgctctacgacgcc
ctctatggcaccgatgccattcccgagaccggcggcgcggaaaagggcaagggcttcaac
ccggcgcgcggcgccaaggtcatcgcctgggccaaggattttctcgaccagtcggtgccg
ctcacctcgggcaaatgggctggggtgaacggcctgtcagtggcgcatggcgcgctgaag
cttggcgccggcgccggcggcaccacgctggccgaccccaggcaattcgccggctatcgc
ggcgatgccgccaaccccgatgccgtgctgctggtgaagaacgggttgcacatcgagatc
gtcgtcgaccgcaacaaccagatcggccgcaccgaccccgccggcattgccgacgtcatc
ctggaatcggcgctgaccaccatccaggactgcgaggattcggtcgcggcggtggatgcg
caggacaaggtcgtcgtctaccgcaactggctcggcctgatgaaaggcgacctcgccgaa
gagatctccaaggctggccggagtttcgtccgcaagctcaacgccgaccgcgcctacacg
gcgcccgccggcggccagatcaccgttcccggccgctcgctgatgctggtcaggaatgtc
ggccacctgatgaccaatccggcaatcctggaccgcgacggcaacgaagtgccggaaggc
atcatggatgccgcgctgacggcgctgatcgcgctgcacgatgtcgggccggagggccgc
cgcgccaattcccgcgccggctcgatgtatgtggtgaagcccaagatgcacgggccggag
gaagtcgccttcgccgtcgagatcttcgaccgcgtcgaggcgctgctcgggatgcccagg
aataccatcaagatgggcatcatggacgaggagcggcgcaccaccgtcaacctcaaggaa
gcgatccgtgccgcgcgcgagcgcgtggtgttcatcaacaccggcttcctcgaccgcacc
ggcgacgagatccacacctcgatggaagccggcccgatgatccgcaagggcgacatgaag
caggccgcctggatttccgcctatgaggcgtggaatgtcgacaccgggcttgaatgcggg
ctggccggccacgcccagatcggcaagggcatgtgggcgatgccggatctgatggcggcg
atgctggaacagaagatcgcccaccccaaggccggcgccaacaccgcctgggtgccgtcg
ccgacggcggcgacgctgcacgccacgcactatcacaaggtcgacgtgcatgccgtgcag
gcggcgctgaagagccggccgaaggcgaaactcgacgacatcttgtcggtgccggtcgcc
gtgcggccgaactggacgcccgacgagatccaacgcgaactcgacaacaacgcgcaaggc
attctcggctatgtcgtgcgctggatcgaccagggcgtcggctgctcgaaagtgcccgac
atcaacgatgtcggcctgatggaagaccgcgccacgctgcgcatctcctcgcagcacatc
gccaactggcttcgccacaaagtgtgttcggagatccaggtgcgcgattccctgcagcgc
atggcggcaatcgtcgaccgccagaatgtcggcgatccgctctaccggccgatggcgccg
gatttcgacaaatccatcgccttccaggccgcctgcgacctggtgttcaagggaaccagc
cagcccaacggctatacggagccggtgctgcacgcgcggcggctggagctgaaggcgcag
agatag

DBGET integrated database retrieval system