KEGG   Mesorhizobium loti: mlr4664Help
Entry
mlr4664           CDS       T00043                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mlo  Mesorhizobium loti
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    mlr4664
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    mlr4664
   00630 Glyoxylate and dicarboxylate metabolism
    mlr4664
Enzymes [BR:mlo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     mlr4664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3698567..3700732
Genome map
AA seq 721 aa AA seqDB search
MTDRIEIAGLRIAGELHDFVAGEALPGTGIAADAFWSGFSAIVHDLAPKNRALLKKRDAM
QERLDGWYRDNGAPVDMEVYKSFLKEIGYLVPEGPAFSVSTDNVDPEIAVVAGPQLVVPV
MNARYALNAANARWGSLYDALYGTDAIPETGGAEKGKGFNPARGAKVIAWAKDFLDQSVP
LTSGKWAGVNGLSVAHGALKLGAGAGGTTLADPRQFAGYRGDAANPDAVLLVKNGLHIEI
VVDRNNQIGRTDPAGIADVILESALTTIQDCEDSVAAVDAQDKVVVYRNWLGLMKGDLAE
EISKAGRSFVRKLNADRAYTAPAGGQITVPGRSLMLVRNVGHLMTNPAILDRDGNEVPEG
IMDAALTALIALHDVGPEGRRANSRAGSMYVVKPKMHGPEEVAFAVEIFDRVEALLGMPR
NTIKMGIMDEERRTTVNLKEAIRAARERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMK
QAAWISAYEAWNVDTGLECGLAGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHKVDVHAVQAALKSRPKAKLDDILSVPVAVRPNWTPDEIQRELDNNAQG
ILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQHIANWLRHKVCSEIQVRDSLQR
MAAIVDRQNVGDPLYRPMAPDFDKSIAFQAACDLVFKGTSQPNGYTEPVLHARRLELKAQ
R
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgcatcgagatcgccggattgcggattgccggcgagctgcatgattttgtg
gctggcgaggccttgcccggcaccggcatcgccgccgatgcgttctggagcggtttttcg
gccatcgtccacgatctcgcgccgaagaaccgggcgctgctcaaaaaacgtgacgccatg
caggaaaggctcgacggctggtatcgcgacaatggcgcgccggtcgacatggaggtctac
aagagcttcctgaaagagatcggctatctcgttcccgaagggccggccttcagcgtgtcg
acggacaatgtcgatcccgaaatcgccgtcgttgccgggccgcagctcgtcgtgccggtg
atgaatgcgcgctatgcgctcaatgccgccaatgcgcgctggggctcgctctacgacgcc
ctctatggcaccgatgccattcccgagaccggcggcgcggaaaagggcaagggcttcaac
ccggcgcgcggcgccaaggtcatcgcctgggccaaggattttctcgaccagtcggtgccg
ctcacctcgggcaaatgggctggggtgaacggcctgtcagtggcgcatggcgcgctgaag
cttggcgccggcgccggcggcaccacgctggccgaccccaggcaattcgccggctatcgc
ggcgatgccgccaaccccgatgccgtgctgctggtgaagaacgggttgcacatcgagatc
gtcgtcgaccgcaacaaccagatcggccgcaccgaccccgccggcattgccgacgtcatc
ctggaatcggcgctgaccaccatccaggactgcgaggattcggtcgcggcggtggatgcg
caggacaaggtcgtcgtctaccgcaactggctcggcctgatgaaaggcgacctcgccgaa
gagatctccaaggctggccggagtttcgtccgcaagctcaacgccgaccgcgcctacacg
gcgcccgccggcggccagatcaccgttcccggccgctcgctgatgctggtcaggaatgtc
ggccacctgatgaccaatccggcaatcctggaccgcgacggcaacgaagtgccggaaggc
atcatggatgccgcgctgacggcgctgatcgcgctgcacgatgtcgggccggagggccgc
cgcgccaattcccgcgccggctcgatgtatgtggtgaagcccaagatgcacgggccggag
gaagtcgccttcgccgtcgagatcttcgaccgcgtcgaggcgctgctcgggatgcccagg
aataccatcaagatgggcatcatggacgaggagcggcgcaccaccgtcaacctcaaggaa
gcgatccgtgccgcgcgcgagcgcgtggtgttcatcaacaccggcttcctcgaccgcacc
ggcgacgagatccacacctcgatggaagccggcccgatgatccgcaagggcgacatgaag
caggccgcctggatttccgcctatgaggcgtggaatgtcgacaccgggcttgaatgcggg
ctggccggccacgcccagatcggcaagggcatgtgggcgatgccggatctgatggcggcg
atgctggaacagaagatcgcccaccccaaggccggcgccaacaccgcctgggtgccgtcg
ccgacggcggcgacgctgcacgccacgcactatcacaaggtcgacgtgcatgccgtgcag
gcggcgctgaagagccggccgaaggcgaaactcgacgacatcttgtcggtgccggtcgcc
gtgcggccgaactggacgcccgacgagatccaacgcgaactcgacaacaacgcgcaaggc
attctcggctatgtcgtgcgctggatcgaccagggcgtcggctgctcgaaagtgcccgac
atcaacgatgtcggcctgatggaagaccgcgccacgctgcgcatctcctcgcagcacatc
gccaactggcttcgccacaaagtgtgttcggagatccaggtgcgcgattccctgcagcgc
atggcggcaatcgtcgaccgccagaatgtcggcgatccgctctaccggccgatggcgccg
gatttcgacaaatccatcgccttccaggccgcctgcgacctggtgttcaagggaaccagc
cagcccaacggctatacggagccggtgctgcacgcgcggcggctggagctgaaggcgcag
agatag

DBGET integrated database retrieval system