KEGG   Mesorhizobium japonicum MAFF 303099: mlr4664Help
Entry
mlr4664           CDS       T00043                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00620  Pyruvate metabolism
mlo00630  Glyoxylate and dicarboxylate metabolism
mlo01100  Metabolic pathways
mlo01110  Biosynthesis of secondary metabolites
mlo01120  Microbial metabolism in diverse environments
mlo01200  Carbon metabolism
Module
mlo_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    mlr4664
   00630 Glyoxylate and dicarboxylate metabolism
    mlr4664
Enzymes [BR:mlo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     mlr4664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: BAB51267
RhizoBase: mlr4664
UniProt: Q98DK4
Position
3698567..3700732
Genome map
AA seq 721 aa AA seqDB search
MTDRIEIAGLRIAGELHDFVAGEALPGTGIAADAFWSGFSAIVHDLAPKNRALLKKRDAM
QERLDGWYRDNGAPVDMEVYKSFLKEIGYLVPEGPAFSVSTDNVDPEIAVVAGPQLVVPV
MNARYALNAANARWGSLYDALYGTDAIPETGGAEKGKGFNPARGAKVIAWAKDFLDQSVP
LTSGKWAGVNGLSVAHGALKLGAGAGGTTLADPRQFAGYRGDAANPDAVLLVKNGLHIEI
VVDRNNQIGRTDPAGIADVILESALTTIQDCEDSVAAVDAQDKVVVYRNWLGLMKGDLAE
EISKAGRSFVRKLNADRAYTAPAGGQITVPGRSLMLVRNVGHLMTNPAILDRDGNEVPEG
IMDAALTALIALHDVGPEGRRANSRAGSMYVVKPKMHGPEEVAFAVEIFDRVEALLGMPR
NTIKMGIMDEERRTTVNLKEAIRAARERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMK
QAAWISAYEAWNVDTGLECGLAGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHKVDVHAVQAALKSRPKAKLDDILSVPVAVRPNWTPDEIQRELDNNAQG
ILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQHIANWLRHKVCSEIQVRDSLQR
MAAIVDRQNVGDPLYRPMAPDFDKSIAFQAACDLVFKGTSQPNGYTEPVLHARRLELKAQ
R
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgcatcgagatcgccggattgcggattgccggcgagctgcatgattttgtg
gctggcgaggccttgcccggcaccggcatcgccgccgatgcgttctggagcggtttttcg
gccatcgtccacgatctcgcgccgaagaaccgggcgctgctcaaaaaacgtgacgccatg
caggaaaggctcgacggctggtatcgcgacaatggcgcgccggtcgacatggaggtctac
aagagcttcctgaaagagatcggctatctcgttcccgaagggccggccttcagcgtgtcg
acggacaatgtcgatcccgaaatcgccgtcgttgccgggccgcagctcgtcgtgccggtg
atgaatgcgcgctatgcgctcaatgccgccaatgcgcgctggggctcgctctacgacgcc
ctctatggcaccgatgccattcccgagaccggcggcgcggaaaagggcaagggcttcaac
ccggcgcgcggcgccaaggtcatcgcctgggccaaggattttctcgaccagtcggtgccg
ctcacctcgggcaaatgggctggggtgaacggcctgtcagtggcgcatggcgcgctgaag
cttggcgccggcgccggcggcaccacgctggccgaccccaggcaattcgccggctatcgc
ggcgatgccgccaaccccgatgccgtgctgctggtgaagaacgggttgcacatcgagatc
gtcgtcgaccgcaacaaccagatcggccgcaccgaccccgccggcattgccgacgtcatc
ctggaatcggcgctgaccaccatccaggactgcgaggattcggtcgcggcggtggatgcg
caggacaaggtcgtcgtctaccgcaactggctcggcctgatgaaaggcgacctcgccgaa
gagatctccaaggctggccggagtttcgtccgcaagctcaacgccgaccgcgcctacacg
gcgcccgccggcggccagatcaccgttcccggccgctcgctgatgctggtcaggaatgtc
ggccacctgatgaccaatccggcaatcctggaccgcgacggcaacgaagtgccggaaggc
atcatggatgccgcgctgacggcgctgatcgcgctgcacgatgtcgggccggagggccgc
cgcgccaattcccgcgccggctcgatgtatgtggtgaagcccaagatgcacgggccggag
gaagtcgccttcgccgtcgagatcttcgaccgcgtcgaggcgctgctcgggatgcccagg
aataccatcaagatgggcatcatggacgaggagcggcgcaccaccgtcaacctcaaggaa
gcgatccgtgccgcgcgcgagcgcgtggtgttcatcaacaccggcttcctcgaccgcacc
ggcgacgagatccacacctcgatggaagccggcccgatgatccgcaagggcgacatgaag
caggccgcctggatttccgcctatgaggcgtggaatgtcgacaccgggcttgaatgcggg
ctggccggccacgcccagatcggcaagggcatgtgggcgatgccggatctgatggcggcg
atgctggaacagaagatcgcccaccccaaggccggcgccaacaccgcctgggtgccgtcg
ccgacggcggcgacgctgcacgccacgcactatcacaaggtcgacgtgcatgccgtgcag
gcggcgctgaagagccggccgaaggcgaaactcgacgacatcttgtcggtgccggtcgcc
gtgcggccgaactggacgcccgacgagatccaacgcgaactcgacaacaacgcgcaaggc
attctcggctatgtcgtgcgctggatcgaccagggcgtcggctgctcgaaagtgcccgac
atcaacgatgtcggcctgatggaagaccgcgccacgctgcgcatctcctcgcagcacatc
gccaactggcttcgccacaaagtgtgttcggagatccaggtgcgcgattccctgcagcgc
atggcggcaatcgtcgaccgccagaatgtcggcgatccgctctaccggccgatggcgccg
gatttcgacaaatccatcgccttccaggccgcctgcgacctggtgttcaagggaaccagc
cagcccaacggctatacggagccggtgctgcacgcgcggcggctggagctgaaggcgcag
agatag

DBGET integrated database retrieval system