KEGG   Mesorhizobium loti: mlr4849Help
Entry
mlr4849           CDS       T00043                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mlo  Mesorhizobium loti
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    mlr4849
  Amino acid metabolism
   00300 Lysine biosynthesis
    mlr4849
Enzymes [BR:mlo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     mlr4849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
3854474..3855667
Genome map
AA seq 397 aa AA seqDB search
MTLPTDPAANLAALIRCASVTPAEGGALGALETMLKPLGFLVDRPVFSEDGTPDIENLYA
RRSGNGPHLMFAGHTDVVPVGDEAAWTHPPFAAEIANGEMYGRGAVDMKGGIACFVAAIA
RHVENNGGPKGSVSLLITGDEEGPAINGTVKLLEWAASRGEKWDASIVGEPTNPDTLGDM
IKIGRRGSLSGSITVNGRQGHAAYPQLADNPVRGLMGLVDALLHPVFDKGTKDFQPTNLE
VTSIDVGNPATNVIPAKATATFNIRFNDTWTAETVQAEIHNRLDQAAKRKKYRPGKKTPV
DYDLVWRDRPSHVFLTRDDKLVDTLAGSIKAAVGKEPTLSTSGGTSDARFIKDYCPVVEF
GLVGKTMHMVDERVALADLETLTRIYQRFIEDWFGQG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgccgaccgaccccgccgcaaacctcgccgcccttatccgttgcgcctcggtg
actccagccgaaggcggcgcgctgggcgcgctggaaacgatgctgaagccgctcggcttc
ctggtcgaccggcccgtcttttcggaagacggcacgccggacatcgagaacctctatgcg
aggcggtccggcaacggcccgcatctgatgttcgccggccataccgatgtcgtgccggtc
ggcgacgaagccgcctggacgcatccgcctttcgccgccgagatcgccaatggcgagatg
tatggccgtggcgccgtcgacatgaagggcggcattgcctgcttcgtcgcggcgatagcg
cgccatgtcgagaacaatggcggccccaagggctcggtctcgctgctgatcaccggtgac
gaggaaggcccggccatcaacggcacggtcaagctgctcgaatgggccgcttccaggggc
gagaaatgggatgcctcgatcgttggcgagccgaccaacccggacacgcttggcgacatg
atcaagatcggccgccgcggctcgctgtccggttcgatcacggtcaatggccgtcagggc
catgccgcctatccgcagcttgccgacaatccggtgcgcggcttgatgggcctggtcgat
gccctgctgcatcccgtcttcgacaagggaaccaaggatttccaaccgaccaatctggag
gtcacctccatcgatgtcggcaacccggccaccaatgtcatccccgcgaaggcgaccgcg
accttcaacatccgcttcaacgacacctggacggccgagaccgtccaggccgaaatccac
aaccggctcgaccaggcggcgaagcgcaagaagtatcggccgggcaagaagacaccggtc
gactatgacctcgtctggcgcgaccggccgagccatgtcttcctgacccgcgacgacaag
ttggtcgacacgcttgccggctcgatcaaggcggcggtcggcaaggagccgacattgtcc
acttcgggcggcacgtcggatgcgcgcttcatcaaggattactgcccggtggtcgagttc
ggcctggtcggcaagaccatgcatatggtcgacgagcgcgtcgcccttgccgatctcgaa
acgctgacgcggatctaccagcgcttcatcgaagactggttcgggcagggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system